KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292270
Entry
DDB_G0292270      CDS       T00245                                 

Gene name
comG
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00340  Histidine metabolism
ddi00350  Tyrosine metabolism
ddi00360  Phenylalanine metabolism
ddi00410  beta-Alanine metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0292270 (comG)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DDB_G0292270 (comG)
   00350 Tyrosine metabolism
    DDB_G0292270 (comG)
   00360 Phenylalanine metabolism
    DDB_G0292270 (comG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0292270 (comG)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     DDB_G0292270 (comG)
SSDB
Motif
Pfam: Aldedh Prominin
Other DBs
NCBI-GeneID: 8628596
NCBI-ProteinID: XP_629680
dictyBase: DDB_G0292270
UniProt: Q54DG1
Position
6
AA seq 470 aa
MSTSAAATLPLSVISKNLRKVFLSQKTRKIDWRYSQLKAIKKMMSENKDNITAAVKKDLG
KHEFEIHQTEIVMIQTELDETISHLESWNKTEKVYSPLHFKPASSYILKEPLGVVLIMSP
WNYPVNLALIPLIGAIAGGNCALLKLSRHSYNISKLLHGLLTKYLDPECFEFDCEGGAPY
ITELLEYKWDHIFFTGSVKVGKIVYQAAAKFLTPVTLELGGKNPCIVDKDTDIKLTARRL
IWGKCWNAGQTCIGLDYLIVHKSILEPLIEEFKVVLKEFFGEDIKKSTSFARIISSAAAE
RLQQLFSMGKVVIGGEADIAERYIAPTVIVDPDLDSPLMQDEIFGPVLPIVTYENIDECL
EFIQNRPHALTLYLFSRDQAIQDKVLDGTQSGSLMINDTLLHFTNPNLPFGGIGDSGIGS
YHGKGTFDIFVHKRGLVQSTTKKFLDLPLRYPPYTPFSDNVAGKILGSGW
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtcaacatcagcagcagcaacattaccattatcggtgatatcaaaaaatttaagaaaa
gtatttctttcacaaaaaacaagaaagattgattggagatattctcaattaaaagcaatt
aaaaagatgatgtcagagaataaagataatattacagcagccgtcaagaaggatcttggt
aaacatgaatttgaaatccatcaaactgaaatcgtaatgattcaaactgaattagatgaa
accatctctcatttagaatcttggaataaaactgaaaaagtttatagtccacttcatttc
aaaccagcttcatcttatatattaaaagaaccattaggtgttgttttaattatgtcacca
tggaattatccagttaatttagcattaataccattaattggtgcaattgcaggtggtaat
tgtgctttattaaaattatcaagacattcatataatattagtaaacttttacatggatta
ttaacaaaatatttggatccagaatgttttgaatttgattgtgaaggtggtgcaccatat
attacagagttattggagtataaatgggatcatatatttttcacaggatcagtaaaggtt
ggtaagattgtttatcaagcagcagcaaaattcttgacaccagtcacattggaattgggt
ggtaagaatccatgcatcgtcgataaggacaccgatattaaattgacagcaagaagatta
atttggggcaaatgttggaatgcaggtcaaacatgtattggtttggattaccttattgta
cataaatcaattttggagcctttgatcgaagagtttaaagtcgtattgaaggaattcttt
ggagaggatattaaaaagtcaacttcttttgcacgtatcattagcagtgccgccgctgaa
cgtttacaacaattgttctcaatgggtaaggttgtaattggtggcgaggccgatatcgcc
gagagatacattgctccaactgttatcgttgacccagatttagattcgccattgatgcaa
gatgagatctttggtccagtcctcccaattgtcacctatgagaatatcgatgaatgtttg
gaatttattcaaaatcgtccacatgctttgactctttatttattctctcgtgatcaagcc
attcaagataaggttttagatggtactcaatccggttctctcatgatcaatgataccctc
ttacatttcacaaatccaaatttaccatttggtggtattggtgatagtggtattggttca
tatcatggtaaaggtacatttgatatctttgttcataaaagaggacttgttcaatcaact
actaaaaaattcttagaccttccacttcgttatccaccatatactccattctctgataat
gtagctggtaaaattttaggttctggttggtaa

DBGET integrated database retrieval system