KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292296
Entry
DDB_G0292296      CDS       T00245                                 

Gene name
rad4
Definition
(RefSeq) DNA repair protein Rad4 family protein
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    DDB_G0292296 (rad4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0292296 (rad4)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      DDB_G0292296 (rad4)
SSDB
Motif
Pfam: Rad4 BHD_3 BHD_1 BHD_2
Other DBs
NCBI-GeneID: 8628599
NCBI-ProteinID: XP_001134493
dictyBase: DDB_G0292296
UniProt: Q1ZXA6
Position
6
AA seq 967 aa
MDYDDIEWEESNNDNSTTTTTTTTTTASPRFDESINNEFDDEDKEEEGDINNSLDTDEEI
GENQDDAGDAEDAIEFEIDTNEFKSKENGKKKRIVKKVDLKEKHNCLYLHRTVLTCYLAN
FKYTINVLSNQYLISIISSFIPKDLINLYSNNYKIISEIKQIPTVDSTPQKSRSRSKSKL
DNTTTTTTTTTTTTTSNTTNKKPPIPFMTCIDEIIKWFFSYFKIDEMADNLNSNNTDKNN
KNNTNNKNKKQTREVINLDDDNENTEERKKEKKFEPIRNSLLYYQLITQTKERKVTKKIF
VELFYMVCLILGYKCRIIRPLSTPPPVPVTPSKLKRIASSSSPQAFSRSKAKSSPSVIRL
NYNIDDDNGNTNNNETKVKKSKSPSKTKTSATSSTKKKIDDVISSKDKKNKEKKEKEKEI
EREKEKEKDKKKSKKKSQFSFDSTDSEDEEEEEEEEEEELIISKPITSRQKSIQANQFKN
TVLNSKISKKTETTMSKKRKTNSSLSSKNKKKNNSDSENDTDNERDSGSDNDDAGDKNNN
KSDQEKDNSSSDSDYKDSKKKLKRSSSEPIKRSRLSNLDDKESKTTTTTTTNTLSNNEKV
EIESWIEVFDHEKKKWISIDLINKEIDKPLNFEKILDPFSYVVAISKYQIKDVTSRYTNN
YIGSSLKRLPIAQIKWWLQLVGDAINNPTEVENDNEPVSKFILDSKKIISVNIDLLNNLS
IDERKSIEEIDVYEKQELIIKESKLPFPSSFAQFKSHPIFVLEKDIAKYCSPDPSSKPLG
LFNETHKIYHKDQIKVLHTSDKWVQNGRMVIEGQQPLKIVKGRSKSNPTSMLFGEWQTKL
FEPAVIGKDGIVPTNSFGNVYLFNSSMCPINGVHLRGKGLIRVAKKLGINFAPALTGWEN
GPKSSYPIIDGVVVAKKFSKKLLDTWLSESSSRAEAELQKKNDEIKARWKRFMKKLLIKN
YIEKTYK
NT seq 2904 nt   +upstreamnt  +downstreamnt
atggactatgacgatattgaatgggaagaatctaataatgataattctaccacaacaact
acaacaacaaccaccacagcttcgccaagattcgatgaaagtataaataatgaatttgac
gatgaagataaagaagaagaaggagatataaataatagtttagacactgacgaagaaatt
ggtgaaaatcaagacgatgctggagatgctgaagatgcaattgaatttgaaattgatacc
aatgaattcaaatccaaagaaaatggtaaaaaaaaaagaattgttaaaaaagtagaccta
aaagaaaaacataattgtttataccttcatagaactgttttaacttgttatttggcaaat
tttaaatatactataaatgttttatcaaatcaatatttaatttcaattatttcatcattt
attccaaaagatttaattaatttatattccaataattataaaatcatatctgaaataaaa
caaattccaactgttgattcaacaccccaaaaatcaagatcaagatcaaaatcaaaactt
gataatactaccactaccactactactaccaccacaaccactacttccaatacaaccaat
aaaaaaccaccaattccatttatgacatgtatagatgaaattattaaatggttcttttct
tattttaaaattgatgaaatggctgataatttaaattcaaataatacagataaaaataat
aaaaataatacgaataataagaataaaaaacaaactagagaagttattaatttggatgat
gataatgaaaatacagaagaaagaaaaaaggagaaaaaatttgaaccaataagaaatagt
ttattatactatcaattaattacacaaactaaagaaaggaaagtaacaaaaaagatattt
gttgaattattttatatggtttgtttaattttgggttacaaatgccgtataattagacca
ttgtcaacaccaccaccagtacctgtaacaccaagtaaattgaaaagaattgcaagttca
tcctcaccacaagcattttcaagatcaaaagcaaaatcatcaccttctgttataagatta
aactataatattgatgatgataacggtaatactaataataatgaaacaaaagttaagaaa
tcaaaatcaccatcaaaaactaaaacttctgcaacatcatcaactaaaaagaaaatagat
gatgtgatttcttcaaaagataaaaaaaataaagaaaaaaaagaaaaagaaaaagagata
gaaagggaaaaagaaaaagaaaaagacaaaaagaaatcaaaaaagaaatcacaatttagt
tttgatagtactgactcagaggatgaagaggaagaggaagaagaagaagaagaagaattg
attattagtaaaccaattacaagtagacaaaaatcaattcaagctaatcaatttaaaaat
acagttttaaattcaaagatttcaaagaaaactgaaactacaatgtcaaaaaaaagaaaa
actaattcttcattatcaagtaaaaataaaaagaaaaataatagtgatagtgaaaatgat
actgataatgaaagagatagtggtagtgataatgatgatgctggtgataaaaacaataat
aaaagtgatcaagaaaaagataattcaagtagtgattcagattataaagatagtaaaaag
aaattaaaaagatcatcatctgaaccaattaaaagatcaagattatcaaatttagatgat
aaagaatcaaaaacaactacaacaacaacaacaaatacattatcaaataatgaaaaagtt
gaaattgaaagttggattgaggtatttgatcatgaaaaaaagaaatggatttcaattgat
ttaattaataaagaaattgataaaccactaaattttgaaaagatattagatccattttca
tatgttgttgccatttcaaagtatcaaataaaggatgtaacatcaagatatacaaataat
tatattggatcatcattaaagagattaccaattgcacaaattaaatggtggttacaatta
gttggtgatgctattaataatccaacagaggttgaaaatgataatgaaccagtatcgaaa
tttatattagattcaaaaaagatcatctctgtcaatattgatctattaaataatttatca
attgatgagaggaaatcaattgaagagattgatgtatatgaaaaacaagaattaataata
aaagagagtaaattaccatttccaagtagttttgcacaatttaaatctcatccaattttc
gtattggagaaagatatcgcaaaatattgttcacctgatccttcatcgaaaccattgggt
ttatttaatgaaactcataaaatttatcataaagaccaaatcaaggttttacatacgtca
gataaatgggtccaaaatggtagaatggtaattgagggtcaacaaccattgaaaatcgtt
aaaggtagatcaaaatcaaatccaacctcaatgttatttggtgaatggcaaactaaactc
tttgaacctgctgtcattggtaaggatggtattgttccaaccaattcatttggtaatgtt
tatttattcaattcttcaatgtgtccaattaatggcgttcatctaagaggtaaaggttta
attagggttgcaaagaaattaggtatcaattttgcacccgcactaactggttgggaaaat
ggtccaaaatcctcttatccaatcattgatggtgtagttgttgcaaagaaattctcaaag
aaacttttggatacttggttatcggaatcaagtagtagagctgaagctgaattacaaaag
aaaaatgatgaaattaaagctcgttggaaacgtttcatgaaaaaattattaattaaaaat
tatattgaaaaaacttataaataa

DBGET integrated database retrieval system