KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292350
Entry
DDB_G0292350      CDS       T00245                                 

Definition
(RefSeq) protein kinase, STE group
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH
Other DBs
NCBI-GeneID: 8628627
NCBI-ProteinID: XP_629713
dictyBase: DDB_G0292350
UniProt: Q54DC8
Position
6
AA seq 1224 aa
MKSFLNKNKNSKKIIILDDNDFSKYQQRYDLQNQNIEIVSSPLQNIRSQQINDGVQMSGS
IQSDLSSSDNFTSSGGFGGGGNSSSNTSNRNSDNSTQRPLMVDIGLEYKYRLALEQNPND
FKALVKWGSLIYKNIKNQMGGKHVDVCLMDWNEELIPIPQNNNNHHNHNHHNNHTSGNFT
GNINSNTTLSNSFFETLNSFNLREPLFDVCGKYQSSLQLSGGSNLLNIPFSTLLNYNLNE
QLNILVNNLNNSSPSSSSSSIKTKNTTSTTTTTTTTKNLNDISNNINNSRVLRSVSLPPA
PPPPPTEDPNSPWSDPILWMKWGDCLFLLCTYLELPMYRATCEKYFKCIQILFKQQEKQH
QQQQQQQQNQQDKEKFEKQNNYNIKLLAIVLRKWGITLSRYSRRMKSQFLMSEWTSDENI
QVEELWKVLHSQSIQSLLISNKISPSLVTQYHLATAYHRHAITLNQFGCQSKEEIYGLIT
NSCKIYYETLLESLSDTFLQQLQLQQQQQPWHDIEYYNNNEIFNDQFKSKSLENWGRALD
VQLSTKLNDEEETIEKEEEDLNSVDEYLTTFSKSVLKGVTPSLEGVVSLCLNSKQALQYK
AINSVSVLCRSSEIVKSPIYNELMDQMTKVESFVSKRDDAESLLSQQKTLKSMPPKLQAY
VRMSGLGEEEIMRNFEIAWNSIYFLTKDTIPNQPIPPNYYRSNKKNKLKQRQLNDSNNQD
EKEEPEEIKPPLLPSIHRTNQLNNNNNNNNNINNNNINNNNINNNKNGNSGGETPSPSSS
FVITPFTSNSQSKFNTQRQFLSNSTLFNLSSSGIFTNNNNNNNGGSTITTTTTNNISPTK
TNGWTLTLPSKAPTRRATVSLININDLINQQQQNQINSVSTLSQNNIILNNNNNLDNKPI
SKYIPNSIIRTTVNPPLLSRCDETIFSSGTPLPLFRDKIKLGTGAFGNVFYAIRKSDSSP
VAIKVLMERTKKDSPIIPELYIHSACNHSNIVTYIESYLCKGHVWIILEYCDGGTVRDLL
QATCTPGNPNNLQLFEETLIAYIITELLEGLVYLRSKGIIHRDLKSRNILLTRKGKVKIA
DFGLATTCSLGRGRTRMCGTMGRIAPEVIRREPYDTQSDIYSLGCLIIEMAEGTVPYGKD
SSLKALFYTAIHQYKLPNPKKYTKEFVDFLYLCLNPDPFKRPTPEMLLHHTFLSGADRGK
SILLGRFKNQDTRKNLLLDNFVAF
NT seq 3675 nt   +upstreamnt  +downstreamnt
atgaaatcatttttaaataaaaataaaaattcaaaaaaaataataatattagatgataat
gatttttcaaaatatcaacaaagatatgatttacaaaatcaaaatattgaaatagttagt
agtccactccaaaatataagatcacaacaaattaatgatggagtacaaatgtcaggatct
attcaatctgatttatcaagttcagataatttcacaagcagtggtggatttggaggtggt
ggtaatagtagctcaaatacaagtaatagaaatagtgacaatagtacacaacgtccatta
atggttgatattggactagaatataaatatagattggcattggaacagaatccaaatgat
tttaaagcattagttaaatggggtagtttaatatataagaatattaaaaatcaaatgggt
ggtaaacatgttgatgtttgtctaatggattggaatgaagagttaataccaataccacaa
aataataataatcatcataatcataatcatcataataatcatacaagtggtaatttcaca
ggaaacattaatagtaatacaacattaagtaattcattctttgaaactttaaattcattt
aacctaagagagccattatttgatgtttgtggaaaatatcaatcatcattacaattatct
ggcggtagtaatttattaaatattcctttctcaactttattaaattataatcttaatgaa
caattaaatattttagttaataatttaaataattcatcaccatcatcatcatcatcatca
ataaaaactaaaaatactacatccacaactacaactacaacaactacaaaaaatttaaat
gatatttcaaataatataaataatagtagagtattaagatcagtatcattaccacctgca
ccacctccaccaccaacagaagatccaaattcaccatggtcagatccaatattatggatg
aaatggggtgattgtttatttcttttatgtacatatttagaattaccaatgtatagagca
acttgtgaaaaatattttaaatgtatacagattttatttaaacaacaagagaaacaacat
caacaacaacaacaacaacaacaaaatcaacaagataaagaaaaatttgaaaaacaaaat
aattataatataaaattattagcaattgtattaagaaaatggggtattacattaagtaga
tatagtagaagaatgaaaagtcaatttttaatgtcagaatggacaagtgatgaaaatatt
caagttgaagaattatggaaagttttacatagtcaatcgattcaatcattattgataagt
aataaaatatcgccatcattggtaacacaatatcatttggctacggcatatcatcgtcat
gcaataacattgaatcaatttggatgtcaatcaaaagaggaaatctatggtttaattaca
aattcttgtaaaatttattatgaaactttattggaatcattatcagatacattcttacag
caactacaacttcaacaacaacaacaaccatggcatgatattgaatattataataataat
gaaatatttaatgatcaatttaaatctaaatcattagagaattggggtagagcattggat
gttcaattatcaaccaaattaaatgatgaagaggaaaccattgagaaagaagaagaagat
ttaaattcagtcgatgaatatttaacaacattttcaaaatcagtgttaaaaggtgttaca
ccatcattggaaggtgtggtttcattatgtttaaattcaaagcaagcacttcaatataaa
gcaatcaatagtgtctctgttttatgtagatcaagtgaaattgtaaaatcaccaatttac
aatgaactcatggatcaaatgaccaaagttgaatcattcgtttcaaaaagagatgatgct
gaatcattattatctcaacaaaaaactttgaaaagtatgccaccaaaattacaagcatac
gttcgtatgagtggtttaggtgaagaagaaattatgagaaattttgaaattgcttggaat
tcaatttatttcctaacaaaagatacaattccaaatcaaccaataccaccaaactattat
agatcaaataaaaaaaataaattaaaacaaagacaattgaatgatagtaataatcaagat
gaaaaagaagaacctgaagaaattaaaccacctttactaccttcaattcatcgtactaat
caattaaataataataataataataataataatataaataataataatataaataataat
aatataaataataataaaaatggtaatagtggtggtgaaactccatcaccatcatcatct
tttgttattacaccttttacatcaaattcacaatcaaaatttaatacacaaagacaattc
ctctcaaattcaactttatttaatttatctagtagtggtatttttactaataataataat
aataataatggtggttcaactataactactacaacaaccaataatatatcaccaactaaa
acaaatggttggactttaactttaccaagtaaagcaccaactagaagagcaacagtttca
ttgattaatataaatgatttaattaatcagcaacaacaaaatcaaataaattctgtatca
acattatcacaaaataatataatattaaataataataataatttagataataaaccaatt
tcaaaatatataccaaattcaattattagaacaacagttaatccaccattattatcaaga
tgtgatgaaactatattttcaagtggtacaccattaccattatttagggataaaattaaa
ttgggtacaggtgcatttggaaatgtattttatgcaattagaaaatcagattcaagtcct
gttgcaattaaagttttaatggaacgtactaaaaaagatagtccaatcatacctgaactc
tatattcatagtgcttgtaatcattcaaatattgttacctacattgaatcctatctatgt
aaaggtcatgtttggatcattttagagtattgtgatggtggtacagttagagatttactt
caagcaacttgtactcctggtaatccaaataatttacaattgtttgaagagactttaatc
gcttatatcatcacagagttattggaaggtttggtttatttacgttcaaagggtatcatt
catagagatttaaagagtagaaatattttgttaactagaaagggtaaagtaaagattgcc
gatttcggtctcgctacaacttgtagtttaggtcgtggtagaactcgtatgtgtggtacc
atgggtagaatcgctccagaggtaattagaagagaaccctatgacacccaatctgatatc
tatagtttgggttgtttaatcattgaaatggctgaaggtaccgttccctatggtaaagat
tcctctttgaaagcattattctatacagcaatccatcaatataaattaccaaatcctaaa
aagtatacaaaagaatttgtagatttcctttatctttgtttaaatcctgaccctttcaaa
agaccaacacctgaaatgttactacatcatactttcctaagtggtgctgatagaggtaaa
tcaatattattaggtcgttttaaaaatcaagatacaagaaaaaatttacttttggataat
tttgttgctttttaa

DBGET integrated database retrieval system