KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292784
Entry
DDB_G0292784      CDS       T00245                                 

Gene name
cog6
Definition
(RefSeq) oligomeric Golgi complex component
  KO
K20293  conserved oligomeric Golgi complex subunit 6
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0292784 (cog6)
Membrane trafficking [BR:ddi04131]
 Endosome - Golgi transport
  Tethering complex
   Conserved oligomeric Golgi (COG) complex
    DDB_G0292784 (cog6)
SSDB
Motif
Pfam: COG6 NACHT Gp49
Other DBs
NCBI-GeneID: 8628851
NCBI-ProteinID: XP_629461
dictyBase: DDB_G0292784
UniProt: Q54CT0
Position
6
AA seq 673 aa
MNSTLSRKIQKVLDIKLDSEDLSNALEELSTFYTSNSIGARRNLRNEIEKRYLDINIQFL
DQFDQLNKNINELVLDFEGIKNSCVDICDHLNSTNRVSSELLKNAHELSCGLKEIKEKEN
TLQQFFKKFKLTPQEEQSLVKKEIDSSFYQTLDRLSEIQNECKKNLLSNQYQKPTYEILE
IITKHQDNAYRRLYQWTKEEIKQLLIIEIPILDSFNNIDQQQQQQQQKVMMLPIALSALQ
NKPLLFKHCLDEISECRTKTISNGFITALSFGGPNGIPRPIEINAHDPQRYLGDMLAWIH
QCLASEFELISTILSKVTIKLNENNNNNVDDNIENNNNNNNNNEELNFIEPIIKVLNNSF
ECINRPLSIRIDQILQSKPGVIITYKMISLLDFYSRMANLITKGSGVCRVSTIFGSIKSN
CLSVFFTQIKDNFDRLERSPTVPSPQDLLPTNDIKDSINKLSELISTFNSSLIPLDEREK
EYTPVFSSFIQKIINLTTFSATSSKLPLISMAVFMINCLSSIKSVLENYTSFTASNLELL
TCQIEAHMDTLVEEQTSELLQQMGIGPKLSILQYSDNKSPLSQIIAMDRLSIVQSIRQFD
NCLEQSFGTLLMPNCEKLSDTTLRSLSKKSVSNLISVAYSSLYSAIHDPFNQYDEPNSIF
QYKPDQIKTMLDF
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgaatagtacattatcaagaaagatacaaaaagttttagacatcaaacttgactctgaa
gatctttcaaatgctttggaagaactatcaacattttatacatcaaattcaattggtgca
agaagaaatcttagaaatgaaattgaaaaaaggtatcttgatataaatattcaattttta
gatcaatttgatcaattaaataaaaatataaatgaattagttttagattttgaaggtatt
aaaaatagttgtgttgatatttgtgatcatttaaattcaaccaatagagtatcaagtgaa
ttattaaagaatgcacatgaattatcatgtggtttaaaagagatcaaagagaaagagaat
acattacaacaattttttaaaaagtttaaattaactcctcaagaggaacaatcattagta
aagaaagaaattgattcaagtttttatcaaaccctagatagattatcagagattcaaaat
gaatgtaaaaaaaacttattatcaaatcaatatcaaaaaccaacttatgaaattttagaa
atcattacaaaacatcaagacaatgcatatcgtagattatatcaatggacaaaagaagag
attaaacaattattaattattgaaattccaattttagatagttttaataatattgatcaa
cagcaacaacaacagcaacaaaaagtaatgatgttaccaattgcattatcagcattacaa
aataaacctttattatttaaacattgtttagatgaaatatcggaatgtagaactaaaacg
atatcaaatggtttcattacagctttatcatttggtggtccaaatggtataccacgtcca
atcgagattaatgctcatgatccacaaagatatttaggtgatatgttggcttggattcat
caatgtttagcttcagaatttgaattaatttcaacaatactttcaaaagttactataaaa
ttaaatgaaaataataataataatgttgatgataatattgaaaataataataataataat
aataataatgaagaattaaattttattgaaccaattataaaagttttaaataatagtttt
gaatgtataaatagaccgttatcaattagaattgatcaaattctacaaagtaaaccaggt
gttataataacttataaaatgatatcattattggatttttatagtagaatggcgaattta
attactaaaggtagtggtgtttgtagagtttccactatattcggctcgataaagtcaaat
tgtttatcagtgtttttcactcagattaaagataatttcgatagattagagagatcacca
actgtaccatcaccacaagaccttttaccaacaaatgatatcaaagattcaattaataaa
cttagtgaactgatatctacattcaacagttcgttaataccattggacgagagagagaag
gagtatacaccagtgtttagtagttttattcaaaagattatcaatttaactacgttctct
gccacatcttcaaagctacctctcattagtatggcggttttcatgatcaattgtctaagt
tcaattaaatcagtgttggagaattacacaagtttcaccgcttcgaatttggagttgctg
acttgccaaatcgaagctcacatggacactttggtggaggagcaaactagcgaacttttg
caacagatgggtattggtccaaagctaagtattctgcaatatagtgataataaatcaccg
ttatctcaaattatagccatggatagattatcaatagtccaatcgattagacaatttgat
aattgtttagaacaaagttttggtacactattaatgccaaattgtgaaaaactatcagac
acaaccctaagatctttatcaaagaaaagtgtttcaaatttaatttcagttgcttactct
tctctctattctgcaattcacgatccttttaatcaatatgatgaaccaaattcaattttt
caatataaacctgatcaaattaaaacaatgcttgatttttaa

DBGET integrated database retrieval system