KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292814Help
Entry
DDB_G0292814      CDS       T00245                                 

Gene name
symA
Definition
(RefSeq) calmodulin-binding protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 8628909
NCBI-ProteinID: XP_629391
dictyBase: DDB_G0292814
UniProt: Q54CM5
Position
6
AA seq 456 aa AA seqDB search
MPEILNSISTKTWLVVTQSCLGGLIFGYATGIIVGARGPIADKFGASIPLQGVIVCSILL
GALIGSFAGGFAADRFGRKPLLLFTAITTIAGAIGSGFGPNVATICILRFIHGLGVGSSS
SVCPLMVSEMVSEKRRGFFGSFFQISITVGILIANILAYAIAGEWKLMFCLGAIPGGLLF
IVWAFIAESPVYLEKQKKKLVRSTSGNEDLTTKGGDCDAASSGSVKKSGFSVIFAKNARK
PMLIGILLAVLAQLTGINAFMYFSTTIFLDAGIDGKNAPEIAAIILQVWNVLTTLIAISF
VDRLGRRFLLFTGSVVMTVCDLLIALFFVVLHGSAKGWASIVFLFIFVAGFEASIGTLFW
FVINEILPEESKSIGAPVINAFQWCFNLILSFFFLVVVEYLGQSTMFWIFGGIGLTTTIL
LYFNLPTSLGKTITSNPINNEVDTKNDSASPSSHNI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatattaaatagtatttcaactaaaacttggttagttgtaacacaaagttgt
ttaggtggtttaatatttgggtacgcaacaggtattattgttggtgcaagaggtccaatt
gcagataaatttggagcatcaattccgttacaaggtgtaattgtatgtagtatattatta
ggtgcattgattggttcatttgctggtggtttcgctgctgatagattcggaagaaagcca
ttacttttattcactgccattacaactattgctggtgccattggttctggattcggtcca
aatgttgcaaccatttgtatacttagatttatacatggtttaggtgttggttcgtcttca
tcagtttgtccattaatggtctctgaaatggtgtctgaaaaaagaagaggtttctttggt
tcattctttcaaatttctattactgttggtattttaattgcaaatatattagcatatgca
attgcaggtgaatggaaattaatgttttgcttgggtgctattccaggaggattactattc
attgtttgggcatttattgctgaatcaccagtttacttggaaaaacaaaagaagaaattg
gtcagatctacaagtggaaacgaagatttaactactaaaggcggagattgtgatgcagct
tcttcaggatctgttaaaaaatctggtttctcggtaatatttgcaaagaacgctagaaaa
ccaatgttgattggtattttattagctgttttggctcaattgactggtattaatgcattt
atgtatttctcaacaacaattttccttgatgctggtattgatggtaaaaacgcaccagaa
attgcagccattatattacaagtttggaatgtattaaccactttgattgccatttcattt
gttgatagacttggaagaagattcttgttattcaccggttcagttgtcatgacagtttgt
gatcttttgattgcattattctttgttgtattacatggttctgcaaaaggatgggcatca
attgttttcttattcattttcgttgcaggttttgaagcttcaattggtacactattttgg
tttgtaattaatgaaatcttaccagaagaaagtaaaagtattggtgcaccagttattaat
gcattccagtggtgtttcaatttgattttatcattcttctttttggttgtcgtagagtat
ttgggccaatcaacaatgttttggatatttggtggaataggtttaacaactaccatttta
ttatatttcaatttaccaacttcattaggaaaaaccataacttcaaatccaatcaacaac
gaagttgatactaaaaatgattctgcctctccatcctcacataatatttaa

DBGET integrated database retrieval system