KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292908
Entry
DDB_G0292908      CDS       T00245                                 

Gene name
ubqO
Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TxDE
Other DBs
NCBI-GeneID: 8628955
NCBI-ProteinID: XP_629436
dictyBase: DDB_G0292908
UniProt: Q54CI0
Position
6
AA seq 77 aa
MQIFVKKVGNSAVSYEFKETDTIERVKAVIEGREGVPIDQQTLSFLGKKLENGRTLGELK
IQPGSTINLSLRLRGGN
NT seq 234 nt   +upstreamnt  +downstreamnt
atgcaaatttttgttaaaaaagttggtaattccgccgtctcatacgaatttaaagaaaca
gatactattgaaagggttaaagctgtaattgaaggaagagaaggtgttccaattgatcaa
caaacattatctttcttaggtaaaaaattagagaatggtcgtactttaggagaattaaaa
attcaaccgggttccacaatcaatttatcacttagattaagaggaggaaattaa

DBGET integrated database retrieval system