KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0293434
Entry
DDB_G0293434      CDS       T00245                                 

Symbol
rasG
Name
(RefSeq) Ras GTPase
  KO
K07827  GTPase KRas
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0293434 (rasG)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ddi04031]
    DDB_G0293434 (rasG)
Membrane trafficking [BR:ddi04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    DDB_G0293434 (rasG)
GTP-binding proteins [BR:ddi04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    DDB_G0293434 (rasG)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 Septin
Other DBs
NCBI-GeneID: 8629223
NCBI-ProteinID: XP_629133
dictyBase: DDB_G0293434
UniProt: P15064
Position
6
AA seq 189 aa
MTEYKLVIVGGGGVGKSALTIQLIQNHFIDEYDPTIEDSYRKQVTIDEETCLLDILDTAG
QEEYSAMRDQYMRTGQGFLCVYSITSRSSFDEIASFREQILRVKDKDRVPMIVVGNKCDL
ESDRQVTTGEGQDLAKSFGSPFLETSAKIRVNVEEAFYSLVREIRKDLKGDSKPEKGKKK
RPLKACTLL
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatacaaattagttattgttggtggtggtggtgtcggtaaaagtgccttaacc
attcaattaatccaaaaccatttcattgatgaatacgatccaactatcgaagattcatac
agaaaacaagttaccattgatgaagaaacttgtttattagatattttagatactgctggt
caagaggaatactctgcaatgagagaccaatatatgagaactggtcaaggtttcctttgt
gtctactctatcacttcaagatcatcatttgatgaaattgcatcattccgtgaacaaatt
cttagagttaaggataaggatagagtaccaatgattgtcgttggtaacaaatgcgatttg
gaatctgatcgtcaagtcacaactggtgaaggtcaagatttagcaaaatccttcggtagt
ccattccttgaaacctctgccaagattcgtgtcaacgttgaggaagctttctattcactc
gtacgtgaaatcagaaaagacctcaagggtgactctaaaccagaaaaaggcaagaagaag
agaccattaaaagcttgtactcttttataa

DBGET integrated database retrieval system