KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0293758
Entry
DDB_G0293758      CDS       T00245                                 

Gene name
H2Bv1
Definition
(RefSeq) histone H2B domain-containing protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID-18kDa TFIID_20kDa
Other DBs
NCBI-GeneID: 8629401
NCBI-ProteinID: XP_628972
dictyBase: DDB_G0293758
UniProt: Q54BC2
Position
6
AA seq 226 aa
MRHRGRRSTQHTHVREGIYIKKLIKQINPACRIQVKSVQILTSLIRDTTISIMNEAFHLV
QLSNKRTLSARDVQTSVRLCTVGEISRHAVSEGVKRVTNFNSAKQYPPQPPPAKTATPSS
PSSIPAPPISHPPIIPHSYLKTKVKQMNYNYRISNSSMHYLSAVIEYLLSEILELSSNGA
VSAKRTLIQPRDIFLAIANDIELHSMYGHVIIPGGGTKPLFNSLSF
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagacatagaggaagacgatcaacacagcatacacatgtaagagaaggaatttacatc
aaaaagttaattaaacaaattaatccagcatgtagaattcaagttaagagtgttcaaatt
ttaactagtttaattagagatacaacaattagtattatgaatgaagcatttcatttagta
caactttcaaataaaagaaccttaagtgcacgtgacgttcaaacttccgttcgtttatgt
actgttggtgaaatttcaagacatgcagtctctgaaggtgttaaaagagttacaaatttt
aattccgcaaagcaatatccaccacaaccaccaccagcaaaaaccgccactccttcatcc
ccttcttcaattcctgctccaccaatttcccacccaccaataatcccacattcttattta
aaaacaaaggtaaaacaaatgaattataattacagaatttcaaattcttcaatgcattat
ttatcagctgttattgaatatttgctttctgaaatattagagttatctagtaatggggca
gtatcagccaagagaactttaattcaaccaagagatattttcttagccattgctaatgac
attgaattacattcaatgtatggtcacgtaatcattccaggtggtggtacaaaaccattg
ttcaattccttatctttctaa

DBGET integrated database retrieval system