KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0295485
Entry
DDB_G0295485      CDS       T00245                                 

Name
(RefSeq) EGF-like domain-containing protein
  KO
K17307  fibulin 1/2
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0295485
   04990 Domain-containing proteins not elsewhere classified [BR:ddi04990]
    DDB_G0295485
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   DDB_G0295485
Domain-containing proteins not elsewhere classified [BR:ddi04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   DDB_G0295485
SSDB
Motif
Pfam: FXa_inhibition cEGF EGF_CA EGF_3 EGF hEGF TIG Plasmod_Pvs28
Other DBs
NCBI-GeneID: 8625292
NCBI-ProteinID: XP_001733016
dictyBase: DDB_G0295485
UniProt: B0G154
Position
4:complement(3666930..3672240)
AA seq 1691 aa
MKSLFLNFIFLLIFLGRVFCQTCPAGTTLANGACVKQVITQITTATCRSGSKSDFYWLSG
SANPCPSGWSVEYPVRTAPITNNQLTWYWCVDILDVGGFTTEVLFSSVLNCGGYQAYTIG
TITFSTTNRYLVVSFCSNQGDMVESNSKPITSDATKNLCTKGKGTITDVRYLEIYSAVCP
SGYTGTAPSCTDINECSTSNGGCAHNCANTAGSFTCSCRAGYTLNSDKKSCTDINECSTN
NGGCNQVCTNSAGSFACSCRAGYTLGTDKKTCVDINECSTNNGGCAHNCANTAGSFTCSC
RAGYTLNSDKKSCTDINECSTNNGGCNQVCTNSAGSFACSCNAGYSLGTDKKTCTDINEC
STNNGGCNQVCTNSAGSFACSCNSGYSLGTDKKTCADINECSTNNGGCNQVCTNSAGSFS
CSCNSGYSLGTDQKTCADINECSTNNGGCNQICTNSVGSFSCSCNSGYSLGTDKKTCTDI
NECSTNNGGCNQVCTNSAGSFSCSCNQGYLLGTDQKTCADINECDQKICGTANCTNTVGS
YQCSCPSGYSFTGSSCVDIDECSTNNGGCAQVCTNSAGGFSCSCNSGYILSTDKKNCNDI
NECSTNNGGCSQVCTNSAGSFSCSCNSGYLLSTDKKTCTDKNECLTNNGGCTQVCTNSVG
SFSCSCNSGFILNSNKLSCDDINECDQKICGTANCTNIPGSYQCSCPSGYSFTGSGCIDI
DECDQKICGTANCTNSPGSYQCSCPSGYSFTGSSCIDIDECSADNGGCSQICTNSVGSFS
CSCNSGFTLNSNKLSCDDINECDQNICGTANCANSPGSYQCSCPNGYSFTGSGCIDIDEC
STDNGGCSQICTNSVGSFSCSCDSGYTLNVDNKKSCDDIDECISNNGGCDQKCANIPGSF
GCYCNSGFALNKNNKTCDDIDECSTNNGDCGQICINQIGSYQCSCNLGFTLNQNNKNCDD
IDECLTNNGDCQHVCKNLQGSFQCSCNSGYLLNQDNKKCDDIDECSTDNGGCIQVCTNSV
GSFSCSCNSGFTLNENKLSCDDIDECENGDNKCVGEFTSCQNTDGSYSCICPSNGFSNNS
TYCEDINECLSNELNECSSNTICENRNGSYVCQCNPSDYSHSSPFTCEPKPIITNFYQKP
FRSNIFVVQGINFVEFDTKVTIGEMICDYVTGNDTYTECSSREGKEVIGNVIVEANNILS
DPFNFIGAPYIVSYSHNPPTIGNDLITITGRNLPTLGLVEIIINSINCPVSQIISNEQIT
CTIGQGSGSYNYIRLYNESVTNTDTTYITYANPIIKSTSNVYSSGGILTVFGENFGLVTK
SFATLSVGNKHCSNVEIKSHTELTCELESTSVIYSQLIDLVVDNLPVANDYYFTYSTLED
TRCPLDCSGKGQCTPSGCVCDIGFTGLSCNETRAEIDPIPPTVDVPSINVGSNNSENGFG
YKITIIRIEELDINDQVEVSIDLLQSKWGRHSSTNQWTFNITLENQSYLEATFEYFKQSR
NITFASNSFVIPSESIKLSFKTQKWPFLRKLNSLRIVVQTETLLLNDDANQCSIDGPTVS
TYNQHLWTTTENPETGMITRFISYASVDGHPVIAHIESLESPSRTTSVIGISVPYFKNES
LIDPDFGMLLNVNNKPTGICEDDKTVDWKLATGVSIGGAAAVAIAGIGAFVFRDRKKKKQ
LNTMLNKKINK
NT seq 5076 nt   +upstreamnt  +downstreamnt
atgaagtcattatttttaaattttatatttttattaatttttttggggagagtattttgt
caaacatgtccagcaggaacaacattagctaatggagcatgtgttaaacaagttataact
caaattactacagccacttgtagatcaggttcaaagagtgatttttactggttatcaggt
tctgcaaatccatgtccatccggatggtcagtggaatacccagtcagaactgcaccaatt
acaaataatcaattaacttggtattggtgtgtagacattttagatgttggaggcttcact
acagaagttcttttctcatcagtgctaaattgtggtggttatcaagcctatacaattggt
acaatcaccttctcaacaaccaatagatatttggttgtttcattttgttcaaatcaaggt
gatatggttgaatcaaattctaaaccaataacatctgatgctactaaaaatttatgtaca
aaaggaaaaggaacaatcacagatgttaggtacctagaaatttattcagcagtttgtcca
agcggttatacaggaacagctccttcatgcacagatataaatgaatgttcaacttcaaat
ggtggttgtgctcataattgtgcaaatacagcaggtagtttcacatgttcttgtagagca
ggttacacattgaatagtgataaaaaatcttgtacagatataaatgaatgttcaactaat
aatggtggttgtaatcaagtttgtacaaattcagcaggtagtttcgcatgttcatgtaga
gcaggttacacattaggtactgataaaaagacttgtgtagatataaatgaatgttcaact
aataatggtggttgtgctcataattgtgcaaatacagcaggtagtttcacatgttcttgt
agagcaggttacacattgaatagtgataaaaaatcttgtacagatataaatgaatgttca
actaataatggtggttgtaatcaagtttgtacaaattcagcaggtagtttcgcatgttca
tgtaatgcaggttattcattaggtactgataaaaagacctgtacagatataaatgaatgt
tcaactaataatggtggttgtaatcaagtttgtacaaattcagcaggtagtttcgcatgt
tcatgtaattcaggttattcattaggtactgataaaaagacttgtgcagatataaatgaa
tgttcaactaataatggtggttgtaatcaagtttgtacaaattcagcaggtagtttctca
tgttcatgtaattcaggttattcattaggaactgaccaaaagacttgtgcagatataaat
gaatgttcaactaataatggtggttgtaatcaaatttgtacaaattcagttggtagtttc
tcatgttcatgtaattcaggttattcattaggtactgataaaaagacctgtacagatata
aatgaatgttcaactaataatggtggttgtaatcaagtttgtacaaattcagcaggtagt
ttctcatgttcatgtaatcaaggttatttattaggtactgaccaaaagacttgtgcagat
ataaatgaatgcgatcaaaaaatatgtggtactgcaaactgtacaaatacagtgggaagt
tatcaatgttcatgtccaagtggttactcatttacaggttcaagttgtgtagatattgat
gaatgttcaactaataatgggggttgtgcacaagtttgtacaaattcagcaggtggtttc
tcatgttcatgtaattctggttatatattaagtactgataaaaagaattgtaatgatata
aatgaatgttcaactaataatggcggctgtagtcaagtttgtacaaattcagcaggtagt
ttctcatgttcatgtaattcaggttatttattgagtactgataaaaagacttgtacagat
aaaaatgaatgtttaactaataatggtggttgtacacaagtttgtacaaattcagttggt
agtttctcatgttcatgtaattcaggttttatattaaattcaaataaattatcatgtgat
gatataaatgaatgcgatcaaaagatttgtggaactgcaaattgcactaatataccagga
agttatcaatgttcatgtccaagtggttattcatttactggttcaggttgtattgatata
gatgaatgcgatcaaaagatttgtggcactgcaaattgtacaaattcaccaggaagttac
caatgttcatgtccaagtggttactcatttacaggttcaagttgtattgatattgatgaa
tgttctgctgataatggtggttgcagtcaaatttgtacaaattcagttggtagtttctca
tgttcatgtaattcaggttttacattaaattcaaataaattatcatgtgatgatataaat
gaatgtgatcaaaatatttgtggaactgcaaattgtgcaaactctccaggaagttatcaa
tgttcatgtccaaatggttactcatttacaggttcaggttgtatcgatattgatgaatgt
tctactgataatggtggttgtagtcaaatttgtacaaattcagttggtagtttctcatgt
tcatgtgattcaggttatactttaaatgttgataataaaaagtcttgtgatgatattgat
gaatgtatttcaaataatggtggttgtgatcaaaaatgtgcaaatattccaggtagtttc
ggatgttattgtaactcaggttttgcattaaataaaaataacaaaacatgtgatgacatt
gatgaatgttcaactaataacggtgattgtggacaaatttgtataaaccaaataggtagt
taccaatgttcatgtaatttaggtttcactttaaatcaaaacaacaaaaattgtgatgat
attgatgaatgtttaactaataatggtgattgtcaacacgtttgtaaaaacttacaaggt
agtttccaatgttcttgtaattcaggttatttattaaatcaagacaataaaaaatgtgat
gatattgatgaatgttctactgataatggtggttgtattcaagtttgtacaaattcagtt
ggtagtttctcatgttcatgtaattcaggttttacattaaatgaaaataaattatcatgt
gatgatattgatgaatgtgaaaatggtgataataaatgtgttggtgaatttacttcttgt
caaaataccgatggttcctattcatgtatttgtccatcgaatggattttcaaataatagt
acctattgtgaagatattaatgaatgtttatcaaatgaattgaatgaatgtagttcaaat
acaatttgtgaaaatagaaatggtagttatgtttgtcaatgtaatccatcagattattct
cattcatctccatttacatgtgaaccaaaacctatcattacaaatttttatcaaaaacca
ttcagatccaatatatttgttgttcaaggtatcaatttcgtagagtttgatacaaaggtt
acaattggtgaaatgatttgtgattatgttactggtaatgatacatatactgaatgttca
agtagagaaggtaaagaagttattggtaatgttatagttgaagcaaataacattttatca
gatcctttcaattttattggtgcaccatatattgttagttattcacataatccaccaact
attggtaatgatttaattacaataactggtagaaatctcccaactttaggtttagttgaa
ataattatcaactcaattaattgcccagtatcccaaataatatcaaatgaacagattact
tgtacaattggtcaaggttcaggtagttacaattatattagattatataatgaatctgta
acaaacacagatacaacctatataacctatgcaaatccaattattaaatcaacatcaaac
gtctattcaagtggtggtattttaacagtttttggtgaaaactttggtttggtaactaaa
tcttttgctactcttagtgttggtaataaacattgtagtaatgttgaaattaaatctcat
acagagttaacttgtgaattagagtcaacatctgttatttactctcaattaattgatttg
gttgttgataatttaccagttgccaatgattactatttcacttactcaacattggaagat
actcgatgcccattggattgtagtggaaaaggtcaatgtactccaagtggttgtgtttgt
gatattggtttcactggtctttcatgtaatgaaactcgtgcagaaattgatccaatccca
ccaacagtcgatgttccatcaattaatgttggtagcaataatagtgaaaatggatttggt
tataaaatcaccatcattagaattgaagaattagatattaatgatcaagttgaagtttca
atcgatttattacaatctaaatggggtcgtcattcatcaactaatcaatggactttcaat
attactcttgaaaatcaatcttatttggaagcaacatttgaatactttaaacaatcacgt
aatattacctttgcttcaaactcttttgtaattccatcagaatcaattaaactttcattc
aaaactcaaaaatggccattccttagaaaattaaattcccttagaatcgttgttcaaact
gaaactcttttattgaatgatgatgccaatcaatgttcaattgatggaccaaccgtttca
acttataatcaacatctttggacaaccactgaaaatcctgaaactggtatgatcacaaga
ttcatttcctatgcatcagttgatggtcatccagttattgcacatattgaatctttagaa
tcaccatctagaaccacttctgtgattggtatttccgtaccatactttaaaaatgaatca
ttaattgatccagattttggtatgctcttaaatgtcaataataaaccaactggtatatgt
gaagatgataaaactgtcgattggaaattagcaactggtgtatcaattggtggtgctgct
gctgttgcaattgctggtataggtgcttttgtatttagagatagaaagaaaaagaaacaa
ttaaatactatgctaaataaaaaaataaataaataa

DBGET integrated database retrieval system