KEGG   Desulfitobacterium dichloroeliminans: Desdi_1027Help
Entry
Desdi_1027        CDS       T02390                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00860  Porphyrin and chlorophyll metabolism
ddl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desdi_1027
Enzymes [BR:ddl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Desdi_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DUF1611 GATase
Motif
Other DBs
NCBI-ProteinID: AGA68544
UniProt: L0F404
Position
1070369..1071940
Genome map
AA seq 523 aa AA seqDB search
MSGNETSGAERQRSKQATRLMIQGTSSNVGKSVLAAAFCRIFYQEGYQVAPFKAQNMALN
SFVTRSGGEMGRAQVVQAQAAGLEPDVRMNPVLLKPTGHTGSQVIILGKSQGTLSALKYH
GEYQRRTWPIVETALHELLEENEIVVIEGAGSPAEVNLKQNDIVNMRVAMEAQAPVLLVA
DIDRGGALASVVGTLELLEPEERQLVRGIVMNKFRGDIKLLQPALDFLEERTGIPVVGVV
PFYDQFKIPEEDSVVLEEQNSKHHKGKNRAEALDVVVIRLPYLSNFTDFDPFEDEPDINL
RYVREVAEVGQPDCVILPGSKNTLSDLRFVWDSGLGEKILDLWRENVPIIGICGGYQMLG
RVVHDPLGTESDLVEMNGLGILPMKTEFAIDKHTVQSHGKVIGTELFFQRCQGTEITGYE
IHMGSSQGEGEPLFAIEAQGETYGDGLLVGSAFGTYLHGIFDNDPLRTALLEWLWEKRGA
QRPVGKTLSQAAIREQAFNELAEWVRNSMDMEKIRSIMGLKKG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaatgaaacgtccggtgcagagaggcagaggagtaagcaggctactcggttg
atgattcagggcacatcgtctaatgtggggaaaagcgtcttggcggctgccttttgtcgg
attttctatcaagagggctatcaggtagctccttttaaggcacaaaatatggccttgaat
tcctttgttacgcgatcaggaggagagatgggcagagcccaggttgtgcaggctcaagct
gcggggttagagcctgatgtacgtatgaatcctgtgttgttaaagccaacagggcatacc
ggctcccaggtaattatactcggtaaatcccagggaacactttccgccttgaagtatcac
ggtgagtatcaaagaagaacgtggcccatcgtggaaacggctcttcatgagcttcttgaa
gaaaacgaaatcgtggtcatcgaaggggcaggaagtcccgccgaagtcaacctcaagcaa
aacgatatcgtcaatatgcgtgtggcgatggaagcccaagcccctgtgcttttggtagca
gatattgatcggggaggagcgttagcttccgtggtgggtacgcttgaacttctggagcca
gaggagcgtcagttggttcgaggtatcgtgatgaacaaattccggggagatattaagctc
ttgcagcctgctcttgattttctcgaagaaagaactggaattcccgtggtgggagtggtc
cctttctatgatcaatttaagatcccggaggaagactctgtggttctggaagagcaaaat
agcaaacaccacaaggggaaaaaccgtgcagaagccttagatgttgttgtgatacgtcta
ccgtatttgtcaaacttcacggattttgatcctttcgaagatgagcctgatatcaacctg
cgctatgtgagagaagtagcagaagttggtcagccggattgtgtgattcttcctgggagt
aaaaataccctatccgatctgcgctttgtatgggatagtggtttgggagagaagattctc
gatctctggcgagagaatgttcctattattggcatctgtggaggctatcaaatgctgggc
agggtggttcatgatcccctcggtacagaatcggatctagtggaaatgaacgggctaggc
attcttcccatgaagacggaatttgccatcgataaacatacggtgcaaagtcatggtaag
gttataggaacagagttattcttccaacgctgccaagggacagagataacaggctatgaa
atccatatgggcagttcccaaggggagggggagcccctctttgcaatcgaagcccaagga
gaaacctatggggatggcttactagtaggtagtgcctttggaacctatctccatggaata
tttgataatgacccactgcggaccgctcttctagaatggctttgggagaaaagaggagca
cagcgacctgtaggaaagaccttgtcacaggcggctatccgtgaacaagcctttaatgaa
ttggctgagtgggtaagaaatagcatggatatggagaaaattcgttctatcatgggtctg
aaaaagggatga

DBGET integrated database retrieval system