KEGG   Desulfitobacterium dichloroeliminans: Desdi_2044Help
Entry
Desdi_2044        CDS       T02390                                 

Definition
(GenBank) putative metal-dependent phosphoesterase, PHP family
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ddl  Desulfitobacterium dichloroeliminans
Brite
KEGG Orthology (KO) [BR:ddl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Desdi_2044
Enzymes [BR:ddl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Desdi_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AGA69489
UniProt: L0F6N3
Position
complement(2093849..2094697)
Genome map
AA seq 282 aa AA seqDB search
MEVGHTQIDLHIHTRESDGSLLVKDVIREAFEREVRILALTDHETTNGVQEAIALSREYN
IKIIPGVELVTAYKGQEVHLLGYFNFAGFLHSDLQSRLKELREQRTALAYDMVKRLQRDG
YTLKWSEVERIANPEGAVSKSHIMRALHDHENGTIQWPSIAKLFQPYGVAYLPFLEHSFE
EAVQLIYACGGVPVLAHPGLIGNQELVGELLSYRPIGLEVYYGYWDQRETLIDHYEKLAK
SKALFTTGGSDFHGLNGPVTIGEVDVPLSCAQDLVSYLKLDL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtgggccatacgcaaatcgatctgcatattcatactagggaatccgatggatct
cttttagtaaaagacgtaatccgcgaggccttcgagcgtgaagtacgtattttagctttg
accgatcacgaaacgactaatggggtccaagaagccatcgccttaagccgcgagtacaat
ataaaaattattccgggggttgaactggttacagcgtataaggggcaagaggttcatttg
ctgggctactttaactttgcaggtttcttgcattctgatctacagtcgcgcctcaaagaa
cttcgcgagcagcgcacggctttagcttatgacatggtcaagcgtcttcagcgagatgga
tatacattaaaatggtcagaagtagaaaggattgccaatccagagggagctgtcagcaaa
agccatattatgagagctctgcatgatcatgaaaatgggacgatccagtggcccagtatt
gctaaattatttcagccatacggggttgcctatctgccttttttagagcattcctttgaa
gaagcggttcaattgatctacgcgtgcggcggggtaccagtgttggcgcatcctggtctc
ataggaaaccaagagctagtgggggagctattgtcctatcgccctatcgggttggaagta
tattatggctactgggatcagcgcgagaccttaatcgatcactatgagaaattagcgaag
agcaaagccctattcacaacgggggggagcgattttcatggccttaacggcccggtaacc
attggcgaagtggatgttccattgtcgtgtgctcaggatctggtgagttatcttaaactt
gacctttaa

DBGET integrated database retrieval system