KEGG   Desulfitobacterium dichloroeliminans: Desdi_2710Help
Entry
Desdi_2710        CDS       T02390                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00071  Fatty acid degradation
ddl00280  Valine, leucine and isoleucine degradation
ddl00310  Lysine degradation
ddl00362  Benzoate degradation
ddl00380  Tryptophan metabolism
ddl00620  Pyruvate metabolism
ddl00630  Glyoxylate and dicarboxylate metabolism
ddl00640  Propanoate metabolism
ddl00650  Butanoate metabolism
ddl00720  Carbon fixation pathways in prokaryotes
ddl00900  Terpenoid backbone biosynthesis
ddl01100  Metabolic pathways
ddl01110  Biosynthesis of secondary metabolites
ddl01120  Microbial metabolism in diverse environments
ddl01130  Biosynthesis of antibiotics
ddl01200  Carbon metabolism
ddl01212  Fatty acid metabolism
ddl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ddl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desdi_2710
   00630 Glyoxylate and dicarboxylate metabolism
    Desdi_2710
   00640 Propanoate metabolism
    Desdi_2710
   00650 Butanoate metabolism
    Desdi_2710
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desdi_2710
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desdi_2710
   00072 Synthesis and degradation of ketone bodies
    Desdi_2710
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desdi_2710
   00310 Lysine degradation
    Desdi_2710
   00380 Tryptophan metabolism
    Desdi_2710
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desdi_2710
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desdi_2710
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desdi_2710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddl04147]
    Desdi_2710
Enzymes [BR:ddl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desdi_2710
Exosome [BR:ddl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desdi_2710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGA70125
UniProt: L0FAT5
Position
2758069..2759376
Genome map
AA seq 435 aa AA seqDB search
MSFRKSEDDIVCISATRTPFGKFGGSLKDIDIYELGAIAMRNAMAKIDLDPALIDEVWWG
NGDTSSTKDPFTPVVARQTMLKAGIPPETPSVAFDQACTSALSTIKYGARSIKLGEAKIV
MTGGATSFSTIPFLLRDIRWEGKKHSSFMVEDPIIPLGYKDYAPVAVDSGNVAIEYGVLR
EEQDELALASHLKYGQARERGFFNNELQPLEIMQKDRKGKTLTSKLLDIDEQFRPNITIE
SLAKLKPIFDNPTCTAGNAPGMNDGATAQIITTRKNAEQLGLPILYTLVSISAIALQPRI
MPVSPAFAIKKCLDEAELTMADIQTIEINEAFACVPLVSLKLLANERFLNSDYQVMVKEA
STQPILDYDPASYQKLKEKLNPNGSAIAVGHPNTASGARIMMTAAYHLKETGGGYAACAI
CGGLTQGAGAIIWVE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccgcaaaagtgaagatgatattgtttgtattagtgcaaccagaacgcccttt
ggtaaattcggtggttcgttgaaagacatcgatatctacgaacttggtgctattgccatg
agaaatgcgatggccaaaattgaccttgacccggctctcatcgatgaagtatggtggggc
aatggggatactagcagcacgaaggatccgttcacacccgttgtagctcgccaaaccatg
cttaaagccgggattccacccgaaaccccgtcggttgctttcgaccaagcctgcacctcc
gccttaagtaccataaaatatggtgctcggagcattaaactaggggaagcaaaaatcgtt
atgactggaggggcgaccagttttagcactattccctttttactccgggatattcgatgg
gaaggaaaaaaacattcttcctttatggttgaagacccaattatccctctgggatacaaa
gattatgcccctgtagcagtagattcaggtaatgtcgccatagagtacggagtattacgt
gaagaacaggatgaattggccctggccagtcaccttaaatacggccaggcccgggaacgc
ggatttttcaacaatgaactgcagccccttgagatcatgcaaaaagatcgcaaaggaaaa
accctcacttccaaacttttagatatcgatgagcaatttcgtccgaatattactatagag
agtctggcaaaactgaaaccgattttcgacaacccgacttgtacagccggcaatgctcca
ggaatgaatgatggtgccaccgctcaaatcatcaccaccagaaaaaatgctgagcaattg
ggtttgcctattctttataccctggtcagtatttccgccatcgccctgcagccaaggatt
atgccggtttccccagctttcgccattaagaaatgcctggatgaagcagaattgaccatg
gctgacatacaaacgattgaaattaatgaagcctttgcttgtgttccgttggtttccttg
aaactcttagctaatgaacgcttcttaaacagtgactatcaggtgatggtcaaagaggcc
tcaactcaacccatcttggattatgatcctgccagctatcaaaagcttaaggaaaaactt
aacccaaatggaagcgcaattgctgtcggacatcctaacaccgcaagtggagcacgcatt
atgatgacggctgcctatcatctcaaagaaaccggcggcgggtatgcagcttgtgcgatt
tgcggcggtctgacacagggtgcaggagctatcatttgggtcgagtaa

DBGET integrated database retrieval system