KEGG   Desulfitobacterium dichloroeliminans: Desdi_3435Help
Entry
Desdi_3435        CDS       T02390                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00520  Amino sugar and nucleotide sugar metabolism
ddl00550  Peptidoglycan biosynthesis
ddl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desdi_3435
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desdi_3435
Enzymes [BR:ddl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Desdi_3435
Peptidoglycan biosynthesis and degradation proteins [BR:ddl01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Desdi_3435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AGA70821
UniProt: L0FDT9
Position
complement(3533465..3534718)
Genome map
AA seq 417 aa AA seqDB search
MNKIIVAGGRSLEGKITVSGAKNAVLPIIAASLLSPEPIRIDDAPHLLDVDVMCQVIGTL
GASVRREGSRLYIETPEITSIEAPHDLVSRMRASIVTMGPVLARTGRVRISHPGGCAIGS
RPINWHLKGLEALGAEVRMDHGYLDVSAPVLKGARIYLDFPSVGATENIMMAAAGAQGMT
YIENAAQEPEIIDLANFLNQMGGKVRGAGTNVIRIEGVREFHGATHTVIPDRIEAGSYLL
MAAAAGGDIFVQNVIADHLKPLLAKMEEAGVYFRVVDDGIRVVGEGVYNAVDVKTQVHPG
FPTDLQAPFSAFLTRANGTGVITETVFENRFMHVDELKRMGSDIKIEGRSAIIQGIQRLN
AAPVTATDLRAGAALILAALTADGETEIQGVHHIDRGYEYIVEKLSGIGAQVRREIE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaaattatcgtggctggcggtaggtctttggaaggaaagattaccgtgagcgga
gcaaaaaacgcagtattgccaattattgctgccagcttgctgtctcctgagcctatacgc
atagacgacgctccacacctattggatgtagatgtcatgtgtcaggttattggaacattg
ggagcttcagtaaggcgagagggttcgcggctttacatagaaacaccagagatcacaagt
atcgaagcgcctcatgatcttgtatcccgcatgagagcttccatcgtaaccatgggacca
gtccttgcaagaacgggcagagtacggatttcccacccgggggggtgcgcgatcggctct
cgaccgattaactggcatcttaagggcctcgaggctttaggcgctgaggtccgaatggat
catggttatttggatgtaagtgctcctgtcttaaaaggagctcggatttacctggatttc
cctagcgtgggagctaccgagaatattatgatggctgctgctggagctcaagggatgact
tatattgaaaatgcagctcaagagccagaaatcattgacttagctaactttttaaatcag
atgggcggtaaggttcggggagccggaaccaatgtgattcgcatcgaaggcgttcgcgaa
ttccatggtgccacccataccgttatacccgaccgtattgaagcaggcagttatcttttg
atggccgccgctgccggtggagatatttttgttcaaaatgtcatagccgaccacctcaaa
ccccttttagcgaaaatggaagaagcaggggtgtacttccgcgttgtagatgatggaata
cgtgtggttggtgaaggagtctataatgccgtggatgtgaagactcaagttcatcctggt
ttccctacggatttgcaagcgccattttcggccttcttaacccgagctaatggcacaggg
gtcatcacggagaccgtctttgagaaccgctttatgcatgtggatgagcttaaacgcatg
ggctctgatattaaaatcgaaggccgtagtgcgattattcaaggtatccagcgtctcaat
gcagccccggtaactgccacagacttacgggctggggctgctttgatactggcggcttta
acagctgatggggaaactgagattcaaggagtccatcatattgaccgcgggtacgagtat
attgtagagaaattgagtggaatcggtgcccaagtccggagagaaatagaatag

DBGET integrated database retrieval system