KEGG   Desulfovibrio desulfuricans ND132: DND132_0545Help
Entry
DND132_0545       CDS       T01709                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00540  Lipopolysaccharide biosynthesis
ddn01100  Metabolic pathways
Module
ddn_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:ddn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DND132_0545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ddn01005]
    DND132_0545
Enzymes [BR:ddn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     DND132_0545
Lipopolysaccharide biosynthesis proteins [BR:ddn01005]
 Unusual sugar
  DND132_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: EGB13761
UniProt: F0JFT3
Position
complement(592967..593491)
Genome map
AA seq 174 aa AA seqDB search
MADATALARKIKLLVLDVDGVLTDGGLYYGDEGLLMKRFNVQDGLGIKMAQAVGLEIGVI
TGLNQRPVENRVRELGIKYYYAGHHRKVPLFEEMCEKAGVAPEEAAYMGDDWIDLAVMRR
AGLALCVPNAVPEAVEAADWVSTRSGGHGAVREAIAFILEARGLKEQALKHWVD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacgcgaccgcgctggcgcggaagatcaagctgctggtgctcgacgtagacggg
gtgctgaccgacggcggcctgtactacggcgacgagggcctcctcatgaaacgcttcaac
gtgcaggacggcctcggcatcaagatggcccaggccgtgggccttgagatcggggtcatc
accggcctgaaccagaggccggtggaaaaccgcgtccgcgagctgggcatcaagtactac
tacgccggacatcaccgcaaggtcccgcttttcgaggagatgtgcgaaaaggcgggggtt
gcccccgaggaggccgcctacatgggcgacgactggatcgacctggccgtcatgcgccgc
gcagggctggccctgtgcgtgcccaatgcggtgcccgaggccgtcgaggccgcggactgg
gtgtccacccgttcgggcggacacggcgcggtccgtgaagccatcgccttcatcctcgag
gcgcgcggcctcaaggaacaggccctcaagcactgggtggactag

DBGET integrated database retrieval system