KEGG   Desulfovibrio desulfuricans ND132: DND132_0596Help
Entry
DND132_0596       CDS       T01709                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00010  Glycolysis / Gluconeogenesis
ddn00052  Galactose metabolism
ddn00500  Starch and sucrose metabolism
ddn00520  Amino sugar and nucleotide sugar metabolism
ddn00521  Streptomycin biosynthesis
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01120  Microbial metabolism in diverse environments
ddn01130  Biosynthesis of antibiotics
ddn01200  Carbon metabolism
Module
ddn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_0596
   00052 Galactose metabolism
    DND132_0596
   00500 Starch and sucrose metabolism
    DND132_0596
   00520 Amino sugar and nucleotide sugar metabolism
    DND132_0596
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DND132_0596
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DND132_0596
Enzymes [BR:ddn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DND132_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: EGB13812
UniProt: F0JG64
Position
complement(650835..651797)
Genome map
AA seq 320 aa AA seqDB search
MAKILAADIGGTHSRFALFEARGNDLEMLDSIWLDTHGARTFPELLEQLWDSEFPVRPGG
FEAAVLAPAGAVYHGLTCPDLPNAPWGIDLREVDFGTPAVRLINDFSAQAYACRTSAVAD
ALVIQAGEPVDGETIGIIGAGTGLGYSALLRTGDTWTALPSEGGHMAFPFIGRDEAEYAE
FNRIESGRNWPEGDSVVTGLGLQLVHRFLTGEDLTPKEISARITPQSETTRWYARFYARA
CRNWAIGLMTTGGMFIAGGVAAKNPMFVQVPDFLEEFHNSHVYQEFLGTIPVRLNANQAS
GLFGAAFFGAQMLAGRGGRG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattctggccgccgacatcggcggcacccacagtcgtttcgccttgttcgag
gcgcggggcaacgacctcgagatgctggattccatctggctcgacacccacggggcgcgg
acctttccggagctcctggaacagctctgggacagcgagttcccggtccggccgggcggc
ttcgaggcggcggtcctggccccggccggggccgtgtaccacggcctgacctgcccggac
ctgcccaacgcgccgtggggcatcgacctgcgcgaggtggacttcggcacgcccgcagtg
cgcctgatcaacgatttttcggcccaggcctatgcctgccgcacctcggccgtggccgac
gccctggtcatccaggccggggagcccgtggacggagagaccatcgggatcatcggggcc
gggaccgggctcggctattccgcgctgctcaggaccggcgacacctggacggccctgccg
tcagagggcggacacatggccttccccttcatcggccgggacgaggccgagtacgcggag
ttcaaccgcatcgaaagcgggcgcaactggcccgagggggactccgtggtcaccggcctg
gggcttcaactcgtgcaccgcttcctgaccggcgaggacctgacgcccaaggaaatctcg
gcccggatcaccccgcaaagcgagaccacccggtggtacgcccggttctacgccagggcg
tgccgcaactgggccatcgggctgatgaccaccggcggcatgttcatcgcgggcggggtg
gcggccaagaaccccatgttcgtgcaggttcccgattttctggaggaatttcacaattcc
cacgtgtaccaggagttcctgggcaccatcccggtccggctcaacgccaaccaggcgagc
ggcctgttcggcgcggccttcttcggcgcacagatgctggccgggcgcggcggaagaggg
tga

DBGET integrated database retrieval system