KEGG   Desulfovibrio desulfuricans ND132: DND132_0862Help
Entry
DND132_0862       CDS       T01709                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ddn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DND132_0862
Enzymes [BR:ddn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DND132_0862
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DND132_0862
    1.1.1.-  
     DND132_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C DAO PALP UDPG_MGDP_dh_N 2-Hacid_dh_C Pyr_redox_3 3HCDH_N TrkA_N ADH_zinc_N_2 Shikimate_DH AdoHcyase_NAD Fer4_6
Motif
Other DBs
NCBI-ProteinID: EGB14077
UniProt: F0JHL7
Position
complement(923243..924319)
Genome map
AA seq 358 aa AA seqDB search
MSETMRAAVWHAREDVRVETVPVPPSPPAGWVKIAVEWCGICGSDLHEYVAGPIFIPVDA
PHPLTGKQGSVILGHEFTGRVVELGDGVTNVKVGDMVAPDACQHCGECVTCRAGRYNVCE
KLAFTGLHNDGAFARYVNVPAELCYVLPEGVSPEAGAVIEPLATGFKAVREAGTILGETV
VVIGAGTIGLGTMMAARAAGAAKVIVLEMSAARIAKAKECGADVVLNPRECDPVAEVKAM
TNGSGADVSFECVGNKMTGPLAVDLIRNAGRAIIVGIFEEPSEFNFFSLSGTDKRIIGTL
AYTLDDFMGVSALLAGGRLTAESLITGRIGLEDIVEKGFLELINNKDENIKILVKLGE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagacaatgcgagccgctgtttggcatgccagagaggacgtgcgggtggagacc
gttcccgttcccccgtcccctccggcgggttgggtcaagatcgcggtcgagtggtgcggc
atctgcgggtcggacctgcacgaatacgtggccgggcccattttcatcccggtggacgct
ccgcatcccctgaccggcaagcagggcagcgtcatcctgggccacgagttcaccggccgg
gtggtggagctgggcgacggcgtgaccaacgtcaaggtcggcgacatggtcgccccggac
gcctgccagcactgcggcgagtgcgtcacctgccgggccggacggtacaacgtctgcgag
aagctggccttcaccggtctgcacaacgacggggccttcgcccggtacgtcaacgttccg
gccgaactctgctacgtgctgcccgagggcgtttcccccgaggccggggcggtcatcgag
ccgctggccacgggcttcaaggccgtgcgcgaggcgggcaccatcctcggcgagaccgtg
gtcgtcatcggcgctgggaccatcggtctgggcaccatgatggccgccagggccgccgga
gcggccaaggtcatcgtcctggagatgtccgccgcccgcatcgccaaggccaaggagtgc
ggcgcggacgtggtcctcaacccccgcgagtgcgatcccgtggccgaggtcaaggccatg
accaacgggtccggggccgacgtgtccttcgagtgcgtgggcaacaagatgaccggcccc
ctggccgtggacctcatccgcaacgcgggccgggccatcatcgtgggcatcttcgaggag
ccgagcgagttcaacttcttcagcctgagcggcacggacaagcgcatcatcggcaccctg
gcctacaccctggacgacttcatgggcgtgtccgccctgctggccggcgggcggctcacg
gccgagtccctgatcaccggacgcatcggcctggaggacatcgtggagaaggggttcctg
gaactgatcaacaacaaggacgagaacatcaagatcctcgtcaagctcggggaatag

DBGET integrated database retrieval system