KEGG   Desulfovibrio desulfuricans ND132: DND132_0973Help
Entry
DND132_0973       CDS       T01709                                 

Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00520  Amino sugar and nucleotide sugar metabolism
ddn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DND132_0973
Enzymes [BR:ddn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     DND132_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD NAD_binding_4 NAD_binding_10 Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: EGB14186
UniProt: F0JID4
Position
complement(1054647..1055741)
Genome map
AA seq 364 aa AA seqDB search
MSPFSDFYQGRKVFLTGHTGFKGAWLALWLHSLGAEVTGYSLAAPSEPNLFEAAGVAKRI
RHVAGDILDAERLERAMAESRPEVVFHLAARGLVLDAYDRPMDTLRTNVIGSANVLEAVR
RTDSVRALVSVSSDKCYDNREQPWGYRETDPLGGHDPYSASKGAMEIVCDSWNRSFFIPE
GRVGAATARAGNVLGGGDFGAHRLVPDYVRAVRDGHPLEVRMPHAVRPWQHVLEPLSGYL
WLAVKLARDPAGFAGPWNFAPLDNACSVETLVETIHCLSGMGSWRDVSDRGRGPHEAGML
KLCGDKAALYLQWKGVLELERTVDMTMRGYGPFLGRALDAGEVCLGQIDEYTAIAARKGR
PWAL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgttttccgatttctaccaaggccgcaaggtcttcctgaccggccataccggg
ttcaagggcgcctggctcgccctctggctccattccctgggcgcggaggtcaccggatat
tccctggccgcaccgtccgagcccaacctgttcgaggccgccggggtggccaagcgcatc
cgccacgtcgccggggacatcctcgatgccgaaaggctggagcgggccatggccgagagc
cgtcccgaggtggtcttccacctggcggcccgtggcctggtcctcgacgcctatgatcgc
cccatggacaccctgcggaccaacgtgatcggctcggccaacgtcctggaggcggtccgc
cggaccgactccgtgcgcgccctggtctccgtgagctcggacaagtgctacgacaaccgg
gaacagccctggggctaccgcgagaccgatcctctgggcgggcacgacccgtacagcgcc
tccaagggggccatggagatcgtctgcgactcctggaaccgctccttcttcattcccgag
gggcgcgtgggcgcggccacggccagggcgggcaacgtcctcggcggcggcgacttcggc
gcgcacaggctggtgccggactatgtccgggccgtgcgcgacggccaccccctggaggtc
cgcatgccccacgccgtgcgcccgtggcagcacgtgctcgagcccttgagcggctatctc
tggctggccgtcaagctggcccgggacccggccggtttcgccggtccctggaatttcgcc
cccctggataacgcctgctccgtggagaccctggtggagaccatccactgtctgagcggc
atgggcagctggcgtgatgtgtccgaccggggacgcgggccgcatgaggcgggcatgctc
aagctgtgcggcgacaaggccgcgctgtacctccagtggaagggggtcctggaattggag
cgaaccgtggacatgaccatgcgcggctacgggccgttcctgggccgggccctggacgcc
ggggaggtctgcctggggcagatcgacgaatacaccgccatcgccgcccgcaagggtcgg
ccttgggccctctag

DBGET integrated database retrieval system