KEGG   Desulfovibrio desulfuricans ND132: DND132_1124Help
Entry
DND132_1124       CDS       T01709                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00260  Glycine, serine and threonine metabolism
ddn00750  Vitamin B6 metabolism
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01120  Microbial metabolism in diverse environments
ddn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DND132_1124
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DND132_1124
Enzymes [BR:ddn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DND132_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: EGB14337
UniProt: F0JBU4
Position
complement(1227621..1228739)
Genome map
AA seq 372 aa AA seqDB search
MTRFVCRDCGLAFDVMVPRWRCDCGGLLDLEFSPRLDPAEVAGRPATLWRYREALPVPEG
AELTLGEGFTPMLEVDLGGRNVLVKQEQLFPTGSYKDRGAAVMMAMAAHIGVTDVVEDSS
GNAGCAVAAFAAKAGIRCRIFVPADNSPGKLGQIELYGAELNPVPGTREDTAAACMAAAE
DRYYASHVYNPFFFHGTKTFAFEVVEQLGWRAPDTVVLPAGNGTLLLGAHIGFTELKAMG
LIDRVPKLVAVQSARCAPLCAAFEAGAATVAQASSEPTLAEGIAIALPMRGEQMLRAVRD
TGGVCLAVSEEAILAAFRDMGRKGFCIEPTSAAVAAGAAEYVRTAPRDEVVVTMFTGHGL
KVGDKLHKLVSD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacccggttcgtctgccgcgactgcggcctggccttcgacgtcatggttccgcgctgg
cgctgcgactgcggcgggctgctggacctggaattttctccgcgcctggacccggccgag
gtggccgggcggcccgccaccctgtggcgctaccgcgaggcgctgcccgtgcccgagggc
gcggagctgaccctgggcgaggggttcacccccatgctcgaggtggacctgggcgggcgc
aacgtgctggtcaagcaggagcagctcttccccaccggctcgtacaaggaccggggcgcg
gcggtcatgatggccatggccgcgcacatcggcgtgaccgacgtggtcgaggactcgtcc
ggcaacgcgggctgcgccgtggcggccttcgcggccaaggcgggcatccgctgccgcatc
ttcgtgcccgccgacaactcgccgggcaagctcggccagatcgaactctacggggccgag
ctcaaccccgtgcccggcacccgcgaggacacggccgccgcctgcatggccgcggccgag
gaccgctactacgccagccacgtgtacaacccgttcttctttcacggcaccaagaccttc
gcctttgaagtcgtcgaacagctcggctggcgcgcgccggacaccgtggtcctgcccgcc
gggaacggcaccctgctgctcggggcgcacatcggcttcaccgagttgaaggccatgggg
ctcatcgaccgcgtgcccaaactggtggccgtgcagtccgcccgctgcgcaccgctctgc
gcggcctttgaggcgggcgcggccacggtggcccaggcgtcctccgaaccgaccctggcc
gagggcatcgccatcgccctgcccatgcgcggcgagcagatgctccgggccgtgcgcgac
acgggcggcgtctgcctggccgtgtccgaggaggccatcctggcggccttccgcgacatg
gggcgcaaggggttctgcatcgagcccacctctgcggcggtggcggccggggccgccgaa
tacgtccggaccgcgccccgtgacgaggtcgtggtgaccatgttcacgggccacgggctc
aaggtcggggacaaactgcacaagctggtcagcgactga

DBGET integrated database retrieval system