KEGG   Desulfovibrio desulfuricans ND132: DND132_1316Help
Entry
DND132_1316       CDS       T01709                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00010  Glycolysis / Gluconeogenesis
ddn00030  Pentose phosphate pathway
ddn00051  Fructose and mannose metabolism
ddn00052  Galactose metabolism
ddn00230  Purine metabolism
ddn00500  Starch and sucrose metabolism
ddn00520  Amino sugar and nucleotide sugar metabolism
ddn00521  Streptomycin biosynthesis
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01120  Microbial metabolism in diverse environments
ddn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_1316
   00030 Pentose phosphate pathway
    DND132_1316
   00051 Fructose and mannose metabolism
    DND132_1316
   00052 Galactose metabolism
    DND132_1316
   00500 Starch and sucrose metabolism
    DND132_1316
   00520 Amino sugar and nucleotide sugar metabolism
    DND132_1316
  Nucleotide metabolism
   00230 Purine metabolism
    DND132_1316
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DND132_1316
Enzymes [BR:ddn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DND132_1316
    5.4.2.8  phosphomannomutase
     DND132_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218 DUF2064 YjeF_N
Motif
Other DBs
NCBI-ProteinID: EGB14525
UniProt: F0JD33
Position
complement(1457131..1458489)
Genome map
AA seq 452 aa AA seqDB search
MKPISREVFRTYDIRGVVDRDFDEEWVERLGRACGQYFLENGSKTAVVGHDCRHSSPGYA
AALTRGLNSTGVNVITIGQVSTPAFYWAVTKLETHAGVMITASHNPSEYNGFKVWQGIST
IHSEEIQDVYELMEKGAFPSGSGTVRHEDVLDKYVAELAGDVTLARPVKVVVDGGNGTGG
LLTADALRKAGAEVVCLFCEPDGDFPNHHPDPVVEKNMAALQQAVLKEKADIGIGLDGDC
DRVGVVTEKGELLFGDQLVAIYARDILKTFPGASIIGEVKCSHLMYDDIKAHGGNAVMWK
TGHSLIKARMREIGAKFAGEMSGHMFFADRYYGFDDATYAALRMVEILSRSDKPMSEQLN
WPKTWSTPEIRVDCPEALKERVVDKAVKYFSSKFEAIDIDGVRAVFPDGWGLIRASNTQP
VLVLRFEAETPERLDEIKTMFETKLKGWIAEG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctatttcgcgggaagtgttcaggacctatgacattcgcggcgtggtggacagg
gatttcgacgaggaatgggtcgagcggctgggccgtgcctgcgggcagtatttcctggaa
aacggctccaagaccgccgtggtcggccacgattgccgccactcctcgcccggctacgcc
gcggccctgacccgtggcctgaactccacgggcgtcaacgtcatcaccatcggccaggtc
tcgaccccggccttctactgggctgtgaccaaactcgagacccacgcgggcgtgatgatc
accgccagccacaacccatcggaatataacgggttcaaggtctggcaggggatcagcacc
atccactccgaggagattcaggacgtctacgaactcatggagaagggcgccttcccctcg
ggttcgggcacggtccggcacgaggacgtgctcgacaagtacgtggccgaactggccggg
gacgtgaccctggcgcggcccgtgaaggtggtcgtggacggcggcaacggcacgggcggg
ctgctcacggccgacgccctgcgcaaggccggggccgaggtggtctgcctgttctgcgag
cccgacggcgatttccccaaccaccatcccgacccggtggtggagaagaacatggccgcc
ctgcaacaggccgtgctcaaggaaaaggcggacatcggcatcggcctggacggcgactgc
gaccgcgtcggcgtggtcacggaaaagggcgaactgctcttcggcgaccaactggtggcc
atctacgcccgcgacatcctcaagacctttcccggcgcgtccatcatcggcgaggtcaag
tgctcgcacctcatgtacgacgacatcaaggcccacggcggcaacgcggtcatgtggaag
accggccattcgctcatcaaggcgcgcatgcgcgagatcggtgccaagttcgcgggcgag
atgtccggccacatgttcttcgccgaccgctactacggcttcgacgacgccacctacgcg
gccctgcgcatggtcgagatcctctcccggtccgacaagcccatgtccgaacagctcaac
tggccaaagacctggtccaccccggaaatccgcgtggactgccccgaggccctcaaggag
cgcgtggtcgacaaggccgtcaaatacttcagctccaagttcgaggccatcgacatcgac
ggcgtgcgcgccgtcttccccgacggctggggcctcatccgcgcctccaacacccagccc
gtcctggtcctccgcttcgaagccgaaaccccggagcgcctcgacgagatcaagaccatg
ttcgaaaccaagctcaaaggctggatcgccgaaggctag

DBGET integrated database retrieval system