KEGG   Desulfovibrio desulfuricans ND132: DND132_3179Help
Entry
DND132_3179       CDS       T01709                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00900  Terpenoid backbone biosynthesis
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01130  Biosynthesis of antibiotics
Module
ddn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DND132_3179
Enzymes [BR:ddn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DND132_3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: EGB16382
UniProt: F0JKD3
Position
complement(3564309..3565175)
Genome map
AA seq 288 aa AA seqDB search
MEADTLIAPAKINLHLEILGLRDDGYHELRTLFYPVSAPCDVIEVLPGPDDDFYIRCPGR
PELETTSNILYKAWKAFGAATGFQPGIFVTLTKRIPMGGGLGGGSSDAAALLRWLNREAG
DRALPLEAMIELAAGLGADVPFFLLDGPAWAGGIGEALTPAEVDLSGATLILACPAIHVD
TAWAFRAWDEKCDAPNIHESLTSAGGGTKNPSPVSPREMTNDFEPVVFEEYPSLRDIKQT
LLAHGAEHAAMSGSGASLFGIYRDRGSATSAVRALEKQGIEIFQVDCP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagacaccctcatcgccccggccaagatcaacctgcacctggaaatcctcggc
ctgcgggacgacggctaccacgagctgcgcaccctcttctacccggtgtccgcgccctgc
gacgtcatcgaggtcctgcccggcccggacgacgacttctacatccgctgccccggacgc
ccggagctggagaccacgtccaatatcctttacaaggcatggaaggccttcggcgcggcc
acgggattccagcccggcatcttcgtcaccctgaccaagcgcatccccatgggcggcggc
ctgggcggcggcagctcggacgcggccgccctgctccggtggctcaaccgggaggcgggc
gacagggcgctgccccttgaggccatgatcgaactggccgccgggctcggcgcggacgtg
cccttcttcctcctggacggcccggcctgggcgggcggcatcggcgaggccctgaccccg
gccgaggtggacctgtccggcgccaccctgatcctggcctgcccggccattcacgtggac
acggcctgggccttccgcgcctgggacgaaaaatgcgacgcgcccaatatccatgaatcc
ttgacatccgcaggggggggtactaagaatccttctcccgtttcgccccgggagatgacg
aacgacttcgagccggtcgtcttcgaggagtacccatccctgagggatatcaagcaaaca
ctcctcgcccacggggccgaacacgccgccatgagcggctcgggagcctccctgttcggc
atatatcgggacaggggttctgccacgtccgcagtccgggctctcgaaaaacaggggatt
gaaatttttcaggtggactgcccctag

DBGET integrated database retrieval system