KEGG   Desulfovibrio desulfuricans ND132: DND132_3351Help
Entry
DND132_3351       CDS       T01709                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00230  Purine metabolism
ddn01100  Metabolic pathways
Module
ddn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DND132_3351
Enzymes [BR:ddn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DND132_3351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_18 ABC_tran AAA_29 RsgA_GTPase AAA_33 AAA_16 AAA_30 IstB_IS21 Rad17
Motif
Other DBs
NCBI-ProteinID: EGB16554
UniProt: F0JKV5
Position
3746697..3747338
Genome map
AA seq 213 aa AA seqDB search
MTFDDHKFRLGQVLVVCAPSGTGKSTLIAMLREEYPDFGFSISYTTRAPRGVEQDGREYH
FVSRETFVAMRSRGAFCEWAEVHGNFYGTATKPVEEMLHRGQDVLFDIDVQGAKQLKKTF
YKGTFVFLLPPSREELVRRLKGRGTDSEESIAKRLTNASGELAQAEWFDYWVVNDDLAEA
YDELKAVYLAGRCKPSLRPGILDNIMQTWKNNG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgacctttgacgatcacaaattccggctgggccaggtcctggtggtctgtgcgcccagc
ggcacgggcaagagcacactgatcgccatgctgcgcgaggaatacccggacttcggcttc
tccatctcctacaccacccgcgccccgcgcggcgtcgagcaggacggccgggagtaccac
ttcgtctcccgcgagaccttcgtggccatgcgcagccggggggccttctgcgagtgggcc
gaggtccacggcaatttctacggcacggccaccaagccggtggaggagatgcttcaccgg
gggcaggacgtgctcttcgacatcgacgtgcagggcgccaagcagctcaagaagaccttc
tacaaggggaccttcgtgttcctgctcccgccgtcgcgcgaggagctggtccgccgtctc
aaggggcgcggcacggactccgaggagtccatcgccaaacggctgaccaatgcctcgggc
gagctggcccaggccgagtggttcgactactgggtggtcaacgacgacctcgccgaggcc
tacgacgaactcaaggccgtgtacctggccggacggtgcaagccgtcgctgaggcccggt
atcctcgacaacatcatgcagacctggaagaacaatggctga

DBGET integrated database retrieval system