KEGG   Desulfovibrio desulfuricans ND132: DND132_3405Help
Entry
DND132_3405       CDS       T01709                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ddn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DND132_3405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ddn03011]
    DND132_3405
Ribosome [BR:ddn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DND132_3405
  Bacteria
    DND132_3405
  Archaea
    DND132_3405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: EGB16608
UniProt: F0JL09
Position
3801627..3801959
Genome map
AA seq 110 aa AA seqDB search
MEAKAVAKFIRVSPRKTRIVAENIKGKGVEDALNILRFTPQKPADILSKVLYSAVSNAEQ
MPGVDVDSLVVASVVVNEGPTWKRIQPRAMGRAYRVRKRTSHITIVVKEQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaagcagttgccaagttcatccgcgtgtcgccgcgcaagacccgcatcgtt
gccgagaacatcaagggcaagggcgtcgaggatgccctgaacatcctgcggttcaccccg
cagaagcccgccgacatcctcagcaaggtgctgtactccgccgtgtccaacgcggagcag
atgcccggcgtggacgtcgattccctggtcgtcgcctcggtcgtggtcaatgaagggccc
acctggaagcgcattcagccgcgcgccatgggccgcgcctaccgcgtccgcaagcgcacc
agtcacatcaccatcgtagtcaaggaacagtag

DBGET integrated database retrieval system