KEGG   Dokdonia donghaensis: I597_0209Help
Entry
I597_0209         CDS       T04309                                 

Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ddo  Dokdonia donghaensis
Brite
KEGG Orthology (KO) [BR:ddo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    I597_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ANH59143
UniProt: A0A0A2GW71
Position
227885..228271
Genome map
AA seq 128 aa AA seqDB search
MVQQVTRGIKISVETTFEGTFYKNYKMHFAFGYKVTIDNQSKDSVQLMARHWKIQDALNT
PEVVNGEGVIGKKPVLKPGESHTYSSGCLLTSPFGSMEGHYQMVNFTTTKKFRVKIPAFK
LSAPFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacaagtaactagaggcataaagatttcggtagagactacctttgagggcacg
ttttataaaaactataaaatgcacttcgcctttggctacaaagtaaccatagacaaccag
agtaaagatagtgtacaacttatggcacgtcactggaaaatacaagacgctcttaacact
cccgaagtcgtaaatggcgagggcgtgataggtaagaaacccgttttaaaaccgggcgaa
agccacacctatagttctggttgcttacttacctcgccttttggctctatggaagggcat
taccagatggtaaactttacaaccacaaaaaaattcagagtaaaaatacctgcctttaag
ctgagcgcaccttttgcattaaactag

DBGET integrated database retrieval system