KEGG   Dokdonia donghaensis: I597_2396Help
Entry
I597_2396         CDS       T04309                                 

Definition
(GenBank) Peptidase family M49
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ddo  Dokdonia donghaensis
Brite
KEGG Orthology (KO) [BR:ddo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ddo01002]
    I597_2396
Enzymes [BR:ddo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     I597_2396
Peptidases [BR:ddo01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   I597_2396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: ANH61293
UniProt: A0A0A2GYJ7
Position
complement(2700699..2702726)
Genome map
AA seq 675 aa AA seqDB search
MKYKGVYALAIAAMVAVGCAEEKKGDNAFAKAEKTATTDFDFTVGQFADIKILRYQIPGF
EDLTLKEQKLVYYMTQAGLAGRDIMWAQNYRHNLAIREALETVYTSDKVEKTGEEWAQFE
TYLKRIWFANGIHHHYSNAKMKPAFSPEYLKKVLAESGATLEGEPFDVLFNDKDSKKVNL
SKDADIVLESAINFYGPDVTTAEAEQFYDAIKVDANEPIEKGLNTRLVKENGKLVEQVYK
SGGLYGEAIDNIIGWLEKAKTVAENEQQEKALGLLIEYYQTGSLDTWDDYCIAWATSTEG
NIDWINGFIEVYNDPKGYKGSYETIVQIKDFDMSKKMAVLSTEAQWFEDNSPLMPEHKKE
TVKGVSYKTVIVAGEAGDASPSTPIGVNLPNNNWIRQTHGSKSVSLGNIINAYNNAGGSG
RLKEFAHDEEEVALEEEYGQLGDKLHTALHEVVGHASGQINKGVGTPKETLKRYKSTIEE
GRADLFGLYYLMDPKLQELGLVEDWEKTGKAAYDGYIRNGLMTQLIRLELGDMVEEAHMV
NRQWVSAWSYERGLEDNVIEKVTRDGKTYYNINDYVKLREIFGELLRETQRITSEGDYEA
AKNLVEDYGVQVDQDIHKEVLDRNSQFKSAPYSGFVNPAIVPTMDGEEITGFSIQQPESF
ESQMLEYASKYGSLK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaggagtatacgcacttgccattgccgctatggtagcagtaggatgcgca
gaagaaaagaagggtgataacgctttcgcgaaagcggaaaaaaccgccaccacagacttt
gattttacagtaggtcaatttgcagatattaaaatactacgttatcaaataccaggattt
gaagatcttacattaaaagagcaaaaactagtgtactatatgacacaggctggtcttgct
ggtcgtgatattatgtgggcacaaaactacagacataatcttgctattagagaggctctt
gagactgtatatacatcagataaggttgaaaaaacaggcgaagagtgggcacagtttgaa
acatacctaaagagaatctggtttgcaaacgggatacatcaccactatagtaatgcaaag
atgaaacctgccttctcaccagagtatcttaaaaaagtacttgcagagagcggcgctacg
ctagaaggtgaaccttttgatgtgctttttaatgataaagacagcaagaaagtaaacctc
tctaaagatgcagatattgtacttgagagtgcgataaatttttatggcccagatgttacc
acagcagaggcagagcagttttatgacgccataaaagtagatgcaaatgagcctatcgaa
aaaggacttaatacgcgtctagtaaaagaaaacggaaaacttgtagagcaagtttataaa
agtggcggtctttatggagaggcgatagataatattataggatggctagaaaaagcaaaa
actgttgccgaaaatgagcaacaagaaaaagctttaggtttacttatcgagtactaccag
acgggaagtctagacacttgggatgattactgtatcgcctgggcaacttctaccgaagga
aatatagactggataaacggttttatagaagtatataatgatcctaagggatataaggga
tcttatgaaaccatcgtacaaatcaaagattttgatatgtcaaaaaagatggcagtactc
tctacagaggcacaatggtttgaagataactcaccacttatgccagagcataaaaaagaa
actgtaaaaggtgtttcttataaaacagtaattgttgctggtgaggccggagatgcatca
ccttctacacctataggagtaaacttacctaacaataactggatacgccagacgcacggt
agtaagtctgtatcactaggtaacataataaacgcatataacaatgcgggaggttctgga
cgtcttaaagagtttgcacacgatgaagaagaggttgcgctagaggaggagtatggtcaa
ctaggggataaacttcacacagcattacacgaggtagtaggtcacgcctctggtcaaatt
aataaaggagtagggacacctaaagaaacgcttaaacgttataaatctaccatagaagag
ggtagagcagacctttttgggctatactaccttatggatccaaaacttcaagaactaggt
cttgtagaagactgggagaaaacgggtaaagctgcttatgacggttacatacgtaatggt
cttatgacgcaacttatacgtttagaacttggtgatatggtagaagaagcacatatggta
aaccgccagtgggtgagtgcttggtcttacgagcgtggtctagaagataatgtgatagaa
aaagttactagagatggtaagacatactataacataaatgactatgtaaagctgcgtgag
atttttggagaacttcttagagagacacaacgcattacttctgaaggtgattatgaagct
gcaaaaaatcttgtagaagattacggagtacaagtagatcaagacattcacaaagaagtg
cttgatcgtaacagccagtttaaaagtgcaccttacagcggttttgtaaacccagctatt
gtgccgactatggatggtgaggagatcactggtttttctatccagcaaccagaaagcttt
gagtcacaaatgctagagtatgcatctaagtatggatcactaaaatag

DBGET integrated database retrieval system