KEGG   Dokdonia donghaensis: I597_2655Help
Entry
I597_2655         CDS       T04309                                 

Gene name
alkH
Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ddo  Dokdonia donghaensis
Pathway
ddo00010  Glycolysis / Gluconeogenesis
ddo00053  Ascorbate and aldarate metabolism
ddo00071  Fatty acid degradation
ddo00280  Valine, leucine and isoleucine degradation
ddo00310  Lysine degradation
ddo00330  Arginine and proline metabolism
ddo00340  Histidine metabolism
ddo00380  Tryptophan metabolism
ddo00410  beta-Alanine metabolism
ddo00561  Glycerolipid metabolism
ddo00620  Pyruvate metabolism
ddo00625  Chloroalkane and chloroalkene degradation
ddo01100  Metabolic pathways
ddo01110  Biosynthesis of secondary metabolites
ddo01120  Microbial metabolism in diverse environments
ddo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ddo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I597_2655 (alkH)
   00053 Ascorbate and aldarate metabolism
    I597_2655 (alkH)
   00620 Pyruvate metabolism
    I597_2655 (alkH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I597_2655 (alkH)
   00561 Glycerolipid metabolism
    I597_2655 (alkH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I597_2655 (alkH)
   00310 Lysine degradation
    I597_2655 (alkH)
   00330 Arginine and proline metabolism
    I597_2655 (alkH)
   00340 Histidine metabolism
    I597_2655 (alkH)
   00380 Tryptophan metabolism
    I597_2655 (alkH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I597_2655 (alkH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    I597_2655 (alkH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I597_2655 (alkH)
Enzymes [BR:ddo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     I597_2655 (alkH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANH61551
UniProt: A0A0A2GSH1
Position
3002457..3003830
Genome map
AA seq 457 aa AA seqDB search
MKIPSILENQRAFFATGQTKDIAYRKAALVRFRESIKNHEQDIIDALTADFKKPAFETVA
TEISVVIKEINLAIKEIWKWQMPKKVKASLLNFPSSAAVHYEPYGTALIIAPWNYPFQLA
VGPMIGAIAAGNTVVLKPSELTPNTANLLEIIITEVFDLAYVHIVQGDKEVAQELLKQRW
DYIFFTGSVPVGKIVYKAAAAYLTPVTLELGGKSPCVVDETALIQQTARRIVWGKFVNAG
QTCIAPDYILVHSSVKDALLKAIAIEITKAYGADPKISQDFARIINEKNFDRLSEMLENA
TIYKGGQTDKNDLYIAPTVLTDVSVADKVMQDEIFGPILPVLTYDKNEEIASVINAMEKP
LSAYVFSRKRSFKNWFNSTFSYGGGAMNDTLIHFINDKLAFGGVGHSGIGSYHGEKSFYT
FSHAKSVVKRGTWLDVPVRYAPYKGKLSLLKKFMNWL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattccatccattcttgaaaatcagcgtgccttctttgcgacgggtcaaactaag
gatatcgcatataggaaagctgctttagtacgctttcgcgaaagcataaaaaatcacgag
caagatatcatagatgccctgacagccgattttaaaaaaccagcatttgaaacagttgct
acagaaataagtgttgtcattaaagaaataaacctagccataaaggaaatctggaaatgg
cagatgccaaaaaaagtaaaggcttctttacttaattttccctctagtgccgccgtacat
tatgagccctatggtactgcattaattattgccccttggaactatccctttcaacttgcc
gtagggcctatgataggcgctattgctgcaggaaatacagtagtattaaaacctagcgaa
cttacacctaacaccgcaaatctcttagaaataataattacagaagtgtttgacctggct
tatgtacacattgtacaaggtgataaagaggtagctcaagaacttcttaaacaacgctgg
gattacatattctttactggtagtgtacccgtaggaaaaatagtttataaagcagccgca
gcatatcttacaccagttaccctagagctaggtggtaaaagtccttgtgtggtagatgag
acagctcttatacaacaaacagccagacgcattgtatggggtaaatttgtaaatgcagga
cagacctgtattgctccagattatatacttgtgcactcctctgttaaagatgcattactc
aaagctatagctatagaaattactaaggcttatggagctgacccaaagatttcacaagat
tttgctcgcataatcaatgagaaaaattttgatagactctctgagatgcttgagaatgca
actatttataaaggtggacaaactgataagaatgacctctatattgctcctaccgtactt
actgatgtatctgtagcagataaggtaatgcaggatgaaatctttggccctatattacct
gtgcttacttatgataaaaatgaggaaattgcatcggttatcaacgctatggaaaaaccg
ctgagtgcgtatgttttttcgcgaaagcgttcttttaagaattggtttaatagcactttt
tcttatggaggtggtgctatgaatgatacacttattcattttataaatgacaagctcgcc
tttggtggtgtgggacactctggtataggtagctatcacggcgagaagagtttttacaca
tttagtcacgcaaagtctgtggtaaaaagaggcacctggctcgatgtgccagtaagatat
gctccatataagggtaaattgagccttcttaaaaaatttatgaactggctgtaa

DBGET integrated database retrieval system