KEGG   Dokdonia donghaensis: I597_2728Help
Entry
I597_2728         CDS       T04309                                 

Gene name
odhB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ddo  Dokdonia donghaensis
Pathway
ddo00020  Citrate cycle (TCA cycle)
ddo00310  Lysine degradation
ddo00380  Tryptophan metabolism
ddo01100  Metabolic pathways
ddo01110  Biosynthesis of secondary metabolites
ddo01120  Microbial metabolism in diverse environments
ddo01130  Biosynthesis of antibiotics
ddo01200  Carbon metabolism
Module
ddo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I597_2728 (odhB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    I597_2728 (odhB)
   00380 Tryptophan metabolism
    I597_2728 (odhB)
Enzymes [BR:ddo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     I597_2728 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ANH61619
UniProt: A0A0A2GV68
Position
complement(3080665..3081984)
Genome map
AA seq 439 aa AA seqDB search
MARFELKLPKMGESVAEATLTSWLKEVGDVIEADEPVLEIATDKVDSEVPSEVDGVLVEK
LFDVDAVIEVGQTIAIIETDGEGGDATATETTVQEVTEEAPAEAAVVAQTVTAAQDAVAA
PVSTDDRFYSPLVRNMAKQEGISQSELDAIQGSGKDGRVTKDDMVSYLANRGTQQSAPVA
QTVKAQPAQKSAPVQKAAPVSVNGEDEVIEMTRMGKLISHHMVASIQTSAHVQSFIEADV
TNIWNWRKKNKDAFAKKEGENLTFTPIFMEAVAKAIRDYPLINISVDGDRIIKRKNINLG
MAAALPDGNLIVPVIKNADQLNLVGMAKSVNDLAGRARDGKLKPDDTAGGTYTVTNVGTF
GSIMGTPIINQPQVAILALGAIRKVPAVIETPDGDFIGIRMKMFLSHSYDHRVVNGALGG
QFVKRVAEYLENFDVNREI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaattaaagctaccaaaaatgggagagagtgttgcagaagcaacgctt
acatcgtggttaaaagaagtaggagatgtcatagaggcagacgagcctgtacttgagatc
gcaacagataaggtagatagtgaagtgcctagtgaagtagacggagtactagtcgaaaaa
ctatttgatgtagatgctgtgatagaggtggggcaaaccatcgctattatagaaacagat
ggtgaaggtggtgatgcaacagctacagagactactgtacaagaggttacagaagaagct
cctgcagaggcggcggtcgttgctcaaacggtaacagcagcccaagatgcggtagcagcg
ccagtaagtacagatgatagattttactcaccgcttgtgcgcaatatggcaaaacaagaa
ggaatctctcaatctgaacttgacgcaatacaaggttctggcaaggacggtcgtgtgact
aaggatgatatggtatcatatcttgcaaaccgcggtactcaacaatccgctccagtagca
cagactgttaaggcgcagccagcacaaaaaagtgcaccggtacaaaaagctgcaccagta
agtgtaaatggtgaagatgaggtgatagagatgactcgtatgggtaaacttatatcgcac
catatggttgcctctatacaaacaagtgctcacgtacaatcatttattgaagcagatgta
actaacatctggaactggcgtaagaagaataaagatgcctttgcaaagaaggaaggtgag
aaccttacatttactcctatatttatggaggcagtagcaaaagcaatacgtgactacccg
cttataaatatctctgtagatggtgatcgtattataaagcgcaaaaacataaacctaggt
atggcagcagctttaccagatggtaaccttattgtacctgttataaagaacgcagaccag
ctcaacctggtaggtatggcaaaatctgtaaatgatcttgctggtagagctcgtgatggt
aaattaaaaccagacgataccgctggaggaacctatacagtgactaacgtaggtaccttt
gggtctataatgggaacacctattataaatcagccacaagttgctatacttgctcttgga
gctatacgtaaagtacctgcagtgatagaaactccagacggagattttataggtatacgt
atgaagatgttcttatctcactcttatgatcaccgtgtggtaaatggagccttaggaggt
cagtttgtaaagagagtagcagagtacctagaaaactttgatgtaaatagagagatctaa

DBGET integrated database retrieval system