KEGG   Dickeya dianthicola: DDI_0263Help
Entry
DDI_0263          CDS       T05141                                 

Definition
(GenBank) NadR transcriptional regulator Nicotinamide-nucleotide adenylyltransferase, NadR family
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00760  Nicotinate and nicotinamide metabolism
ddq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DDI_0263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ddq03000]
    DDI_0263
Enzymes [BR:ddq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     DDI_0263
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     DDI_0263
Transcription factors [BR:ddq03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    DDI_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 CTP_transf_like HTH_26 MMR_HSR1 Citrate_ly_lig HTH_35 AAA_16 HTH_37 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ATO31431
Position
complement(248504..249760)
Genome map
AA seq 418 aa AA seqDB search
MSPYDYLKTAIRQKGCTLQQVADAAGMTKGYLSQLLNAKIKSPSAQKLESLHRFLGLEFP
YQQKSIGVVFGKFYPLHTGHIYLIQRACSQIDELHVILGYDEPRDRLLFEHSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSRGIKQFMAEKGIDPRCVYTSEE
QDAPQYKEHLGIDTVLIDPRRSFMSISGAQIRQDPFRYWEYIPTEVKPFFVRTVAVLGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYIDFAVK
YANKVTFIDTDFITTQAFCKKYEGREHPFVQALVEEYRFDLVILLENNTPWVADGLRSLG
SAADRQAFQDVLKSMLAENHVPYVHVTESDYDSRFLRCVELVQQMLGHDQQTPLPAAS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctccctatgattacctgaaaacagccatcagacaaaaaggctgtaccctgcaacag
gtcgccgatgccgcgggtatgaccaaaggctacttaagccaattgctcaacgccaaaatc
aaaagccccagcgctcagaagctggagtcgctgcaccgttttctgggactggaatttcct
tatcagcaaaaaagcatcggcgtggtattcggcaagttttacccgctgcacaccggccac
atttacctgattcagcgcgcctgcagccagatagacgaattgcacgtgattctgggctac
gacgaaccgcgcgaccgcctactgttcgagcacagttccatgtcgcaacagcccaccgtc
agcgaccgcctgcgctggctgctgcaaaccttcaagtatcagaaaaatatccatattcac
gccttcaacgaacaaggcatggaaccctatccgcacggctgggatgtgtggagccgcggc
atcaagcagttcatggcggaaaaaggcatcgacccccgctgcgtttacaccagcgaagag
caagacgcaccgcagtacaaggaacatctcggcatcgacaccgtgctgatcgaccccagg
cgctcctttatgagcatcagcggcgcgcagatccgtcaggatccgttccgctactgggaa
tatattcccaccgaggtgaagccgtttttcgtgcgcaccgtggcggttctgggcggcgaa
tccagcggcaagtccacgctggtcaacaagctggccaatattttcaataccaccagcgcc
tgggaatacggccgtgattacgtgttctcccacctcggcggtgacgaaatggcgctacag
tattcggattacgacaaaattgcgctcggccaggcccagtacattgatttcgcagtgaaa
tacgccaataaagtgacgtttatcgacaccgatttcatcactacgcaggcgttttgcaaa
aaatacgaaggccgcgagcacccgttcgtgcaggcgctggttgaagagtaccgctttgat
ctggtgattctgttggagaacaacaccccctgggtggcggacggcttgcgcagcctgggc
agcgcagcggaccgtcaggcgtttcaggatgtgcttaagagtatgctggcggaaaatcac
gtaccgtacgttcacgtcaccgaatcagactacgacagccgctttctgcgctgcgtggaa
ctggtgcagcaaatgctggggcacgaccagcaaacgccgctgccggcggcgagttaa

DBGET integrated database retrieval system