KEGG   Dickeya dianthicola: DDI_1029Help
Entry
DDI_1029          CDS       T05141                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00520  Amino sugar and nucleotide sugar metabolism
ddq01100  Metabolic pathways
ddq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DDI_1029
Enzymes [BR:ddq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     DDI_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ATO32197
Position
complement(1022670..1023821)
Genome map
AA seq 383 aa AA seqDB search
MYALTNGRIFTGHQILDGHAVVVADGVIEAVCPTRELPDDLPRRDLAGALLAPGFIDLQL
NGCGGVQFNDALSSLSVKTLETMQKANEKSGCTSFLPTLITSSDEFMRHSIGVMRAWLAQ
HRHQALGLHLEGPWLNPVKKGTHDAAFIRQPDESSLNYLCDNADVISKITLAPEMVSAAV
IRQLAAAGIVVSAGHSNATWEQAKQGFAAGIRFATHLFNAMPGVAGREPGLVGAIYDAPE
VYCGIIADGHHVSWANIRNSKRIKGDKLVLVTDATAPAGADIDRFTFAGKTIYYRDGICV
DEHGTLSGSALTMIDAVRNCVEHAGIALDEALRMATLYPARAIREDHRLGSIETGHVANL
TVLTRDFDILNTFVNGEEVFHKQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtacgctttaaccaacggccgtatttttaccggccaccagatccttgacggccatgcg
gtcgtcgttgccgacggagtgatcgaggcggtctgcccgacacgcgaactgcctgacgac
ctaccccggcgcgatctcgccggcgcattactggcccctggctttatcgacctgcaattg
aacggctgcggcggcgtccaattcaacgacgcactgagcagcttgtccgtcaaaacactg
gaaaccatgcagaaggccaacgaaaaatccggctgtaccagctttttgccgacgctaatc
acttcctccgacgaattcatgcgtcacagcatcggcgtgatgcgcgcctggctcgcccag
catcgccatcaggcgctgggcctgcatctggagggcccctggctcaatccggtgaaaaaa
ggcacccatgacgccgcctttatccgccagccggacgagtcatcgctcaattacctgtgc
gataacgccgatgtaatcagcaaaatcaccctggcgccggaaatggtgtcggcagcggtc
atccggcaactggccgccgcgggtatcgtggtgtccgccggtcactccaacgccacctgg
gaacaggccaaacaaggttttgccgctggtatccgctttgccactcacctgttcaacgcc
atgccgggcgttgccgggcgcgaacccggtctggtcggcgccatctatgacgcgccggaa
gtctactgcggcatcatcgccgacggccaccatgtcagttgggccaacatccgcaacagc
aaacgcatcaagggcgacaaactggtgctggtcaccgacgccacggcaccggccggcgct
gacatcgaccggttcacatttgccggtaaaaccatatactaccgcgacggcatttgcgtg
gatgagcacggcaccctgagcggttcggcgcttaccatgatcgatgcggtgcgcaattgc
gtagaacacgcgggtatcgctctggatgaggcgctaagaatggcgacgctctacccggcg
agagccatcagagaagaccaccgactgggaagcatcgagacgggccacgtggctaacctg
acggtattgacccgcgattttgacatcctcaatacgtttgtgaatggtgaagaagtcttt
cataaacagtaa

DBGET integrated database retrieval system