KEGG   Dickeya dianthicola: DDI_1130Help
Entry
DDI_1130          CDS       T05141                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00030  Pentose phosphate pathway
ddq00480  Glutathione metabolism
ddq01100  Metabolic pathways
ddq01110  Biosynthesis of secondary metabolites
ddq01120  Microbial metabolism in diverse environments
ddq01130  Biosynthesis of antibiotics
ddq01200  Carbon metabolism
Module
ddq_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ddq_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DDI_1130
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DDI_1130
Enzymes [BR:ddq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     DDI_1130
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     DDI_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH ApbA 3HCDH_N NAD_binding_11 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN
Motif
Other DBs
NCBI-ProteinID: ATO32298
Position
1128685..1130091
Genome map
AA seq 468 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSADKTDEVIAENPGKKLVPCYTVEEF
VASLEKPRRILLMVKAGEATDKTIESLKPYLEKGDILIDGGNTFYKDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILQQIAARAEGEPCVTYIGADGAGHY
VKMVHNGIEYGDMQLIAEAYALLKQALGLSNDELASTFAEWNKGELSSYLIEITADIFTK
KDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYLSSLKNQRVAASK
VLSGPVAQAFSGDKAEFVEKVRRALYLGKIVSYAQGFSQLKAASDENSWSLNYGEIARIF
RAGCIIRAQFLQKITDAYAENADIANLLLAPYFRQVADEYQQALRDVVSYAVQQGIPTPT
FSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacagcaaattggcgttgtcggtatggcggtaatggggcgcaatctggcgctg
aatattgaaagccgtggctataccgtttccgtctttaaccgttccgcagacaaaacggat
gaggtgattgcagagaacccagggaaaaaactggtgccgtgctacaccgtggaagagttt
gttgcatctctggaaaaaccgcgccgtatcctgttgatggtgaaagcgggcgaagcgacg
gataaaactatcgagtccctgaaaccgtatctggaaaaaggcgacatcctgatcgacggc
ggcaacacgttctataaagacaccatccgccgtaaccgtgaattgtccgccgaaggattc
aacttcatcggcaccggcgtgtccggcggtgaagaaggcgcgctgaaaggtccgtccatt
atgccgggcggccagaaagaagcctatgagctggtggcgcctatcctgcagcagattgcc
gcccgcgccgaaggcgagccttgcgtgacctatattggcgctgacggcgccggtcactac
gtaaaaatggtgcataacggcatcgagtacggcgacatgcagctgatcgccgaagcctat
gcgctgctgaagcaggcgctcgggctttccaatgatgaactggcgagcaccttcgccgag
tggaacaagggcgaactgagcagctacctgattgaaatcacggccgatatcttcaccaag
aaagacgaagagggtaaatacctggtcgacgtgattctggatgaagccgccaacaaaggc
accggcaagtggaccagccagagctcgctggatctgggcgaaccgctgtccctgattacc
gagtcggtgtttgcccgttacctgtcctcgctgaaaaaccagcgcgtcgcggcttctaaa
gtgctgagcggcccggttgctcaggcgttcagcggcgacaaagccgagttcgtcgaaaaa
gtgcgtcgcgcgctgtatctgggtaaaatcgtctcttatgcacagggtttctcccagttg
aaagcggcgtctgacgaaaacagctggagcctgaactacggcgaaatcgccagaattttc
cgtgccggctgcatcatccgcgcccagttcctgcagaagatcaccgacgcctacgccgag
aacgccgatatcgccaacctgctgctggcgccgtacttccgccaggtagccgacgaatat
cagcaagcgctgcgtgatgtggtgtcctatgcggtacagcagggtattccgaccccaacc
ttctcggcggcgattgcctattatgacagctaccgttccgccgtattaccagccaacctg
attcaggcccagcgcgattatttcggcgcacatacctataagcgtattgataaagaaggc
gtattccacaccgaatggttggaataa

DBGET integrated database retrieval system