KEGG   Dickeya dianthicola: DDI_2237Help
Entry
DDI_2237          CDS       T05141                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00010  Glycolysis / Gluconeogenesis
ddq00071  Fatty acid degradation
ddq00350  Tyrosine metabolism
ddq00625  Chloroalkane and chloroalkene degradation
ddq00626  Naphthalene degradation
ddq01100  Metabolic pathways
ddq01110  Biosynthesis of secondary metabolites
ddq01120  Microbial metabolism in diverse environments
ddq01130  Biosynthesis of antibiotics
ddq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDI_2237
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDI_2237
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DDI_2237
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DDI_2237
   00626 Naphthalene degradation
    DDI_2237
Enzymes [BR:ddq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DDI_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ATO33405
Position
complement(2267558..2268706)
Genome map
AA seq 382 aa AA seqDB search
MSSAFYIPALNLMGEGALEEAARQIQLQGFKHALIVTDGVLNKIGVAASVQQLLKKYYID
SAIYDGVQPNPTVANVDAGLKILKANHSDCVVSLGGGSSHDCAKGIALLATNGGEIADYE
GVDVSAKPQLPLIGINTTAGTASEMTRFCIITDEVRHVKMAIVDKNVTPVMSVNDPVLMV
GMPASLTAATGMDALTHAIEAYVSTAANPITDAVAIKAIELIRDHLRDAVKDGKNMVARE
QMAYAQFMAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAVLLPHVERYNASVASARLK
DVAIALGVDVAGLSDRQGADAAIAAISQMAHDVGIPAGLKDLGVKEEDFNILADNALKDA
CGVTNPKQATHAEIVSIFAAAF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcattttatattccggccttgaacctgatgggtgaaggtgcgttagaggaa
gcggccaggcagattcagttgcagggtttcaaacatgccttgatcgtaactgacggcgtg
ctgaacaaaatcggcgtcgccgcctccgtacagcaattgctgaaaaaatactatatcgac
agcgccatttatgacggcgtgcagccgaacccgaccgtcgccaacgtggatgccggcctg
aagattctgaaggcgaaccacagcgattgcgtggtgtcgctgggtggcgggtcttcccac
gactgcgccaaagggatcgctctgctggcgaccaatggcggcgagatagccgattatgaa
ggcgtggatgtttccgccaaaccgcagctgccgctgatcggcatcaacaccacggcgggc
actgcgtctgaaatgacccgcttctgcatcattaccgatgaagtgcgtcatgtgaaaatg
gcgatcgtcgataaaaacgtgaccccggtgatgtcggtcaacgacccggtcctgatggtc
ggcatgccggcatcgctgaccgccgcgaccgggatggacgcgttgacccacgccatcgaa
gcttatgtatcgactgccgccaacccgattaccgatgcggtggcgatcaaagcgattgaa
cttatccgcgatcatctgcgtgatgcggtcaaagacggtaaaaacatggtagcgcgcgaa
cagatggcttacgcccagtttatggctggcatggcgttcaacaacgcgtcgctgggatat
gttcatgcgatggcgcaccagttgggcggcttctataacctgccgcacggggtgtgcaac
gcggtgctgctgccgcacgtggagcgctacaacgcgagcgtggcctcggcccgactgaaa
gacgtggcgatagcgctgggtgtggatgtcgccgggctgagcgatcggcagggcgctgac
gcggcgatcgcggcgatcagccagatggcgcatgatgtcggcatcccggccgggttgaaa
gatctgggcgtgaaagaagaagacttcaacattctggcggacaacgcgctgaaggacgcc
tgcggggtaaccaacccgaaacaagcaacccacgcggaaatcgtgagtatttttgccgcc
gcattctga

DBGET integrated database retrieval system