KEGG   Dickeya dianthicola: DDI_2987Help
Entry
DDI_2987          CDS       T05141                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00230  Purine metabolism
ddq00240  Pyrimidine metabolism
ddq01100  Metabolic pathways
ddq01110  Biosynthesis of secondary metabolites
ddq01130  Biosynthesis of antibiotics
Module
ddq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ddq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ddq_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
ddq_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DDI_2987
   00240 Pyrimidine metabolism
    DDI_2987
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddq04131]
    DDI_2987
Enzymes [BR:ddq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     DDI_2987
Membrane trafficking [BR:ddq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    DDI_2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ATO34155
Position
complement(3094678..3095109)
Genome map
AA seq 143 aa AA seqDB search
MTVERTFSIIKPNAVAKNAIGAIYARFESAGFTIIASKMLHLSREQAEGFYAEHQGKPFF
DGLVDFMTSGPIMVQVLQADNAIQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD
SVESAEREIAYFFSADDVFPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacggtagaacgtaccttctcgattatcaaaccgaacgcagttgccaaaaacgcaatc
ggcgcgatttacgcccgtttcgaaagcgcgggtttcaccattattgcttccaaaatgctg
cacctgagtcgtgagcaggcggaaggtttctacgccgaacaccaaggcaaaccgtttttt
gacggcctggtggatttcatgacctccggtccgatcatggttcaggtactgcaggctgac
aacgcgattcagcgtaaccgcgatatcatgggtgccactaacccggccaacgcactggct
ggcacgctgcgtgcggattacgccgacagcttcaccgcaaacgcggtgcatggttctgat
tccgtggaatctgccgagcgtgaaatcgcttatttcttcagcgcggacgacgttttcccg
cgtacccgctaa

DBGET integrated database retrieval system