KEGG   Dickeya dianthicola: DDI_4034Help
Entry
DDI_4034          CDS       T05141                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ddq  Dickeya dianthicola
Pathway
ddq00471  D-Glutamine and D-glutamate metabolism
ddq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DDI_4034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ddq01011]
    DDI_4034
Enzymes [BR:ddq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DDI_4034
Peptidoglycan biosynthesis and degradation proteins [BR:ddq01011]
 Precursor biosynthesis
  Racemase
   DDI_4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ATO35202
Position
complement(4164785..4165576)
Genome map
AA seq 263 aa AA seqDB search
MFDSGVGGLSVYDEVRKLLPDLHYIYTFDNEAFPYGEKSEQFIIERVLSIVDAVEKQHPL
SLVIIACNTASTISLPALRARFNFPVVGVVPAVKPAAKLTRNGVVGLLATRATVQRPYTH
ELISRFANDCQILLLGSAELVEWGEAKLQGETVPEDALRKILKPWLKLAEPPDTVVLGCT
HFPLLSEELQQVLPDGTRLVDSGTAIARRTAWLIEHLENPKLSTECNLAYCLSITPKVAA
LSPVLRRYGFNSLERLMLLPAGE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgattccggggtgggcggtttgtccgtttatgatgaagttcgcaaattgctgccg
gacttacattatatctacacctttgataatgaggcttttccctacggggaaaagtctgag
caatttatcattgagcgcgtgctttctattgttgacgcggtggaaaaacaacacccgctg
tcattggtaatcatcgcctgtaatacagccagtacgatttcactcccggcactgcgtgcg
cgttttaattttcccgtcgtcggtgtggtacctgcggtaaaaccggctgccaaattgacc
cggaacggcgtcgttgggttgctggcgacacgtgctacggtccagcgcccttatacgcac
gaactgatttcccgctttgctaatgactgccaaattctgctgctggggtctgctgagctg
gtggaatggggggaagccaagcttcagggggagacggtacctgaggacgcgttgcggaaa
atcctcaagccctggctaaaattggcagagcccccagatacggttgttctgggatgtact
catttccctctcctgtcggaagagttgcagcaggtattgcctgatggcacacggcttgtc
gattcgggcactgctattgcgcgcagaacagcgtggctgattgagcatctggagaatccg
aaattgtcgacagagtgtaatctggcttactgtttatcgattacaccgaaggtcgcggcg
ctgtcgccggttctgcgccgttatggtttcaattcgcttgaacgattaatgcttttgccg
gctggcgagtaa

DBGET integrated database retrieval system