KEGG   Deinococcus deserti: Deide_10930Help
Entry
Deide_10930       CDS       T00880                                 

Definition
(GenBank) putative Arginine--tRNA ligase (Arginine translase) (Arginyl-tRNA synthetase)
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ddr  Deinococcus deserti
Pathway
ddr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ddr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Deide_10930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ddr01007]
    Deide_10930
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ddr03016]
    Deide_10930
   03029 Mitochondrial biogenesis [BR:ddr03029]
    Deide_10930
Enzymes [BR:ddr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Deide_10930
Amino acid related enzymes [BR:ddr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Deide_10930
Transfer RNA biogenesis [BR:ddr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Deide_10930
 Prokaryotic Type
   Other AARSs
    Deide_10930
Mitochondrial biogenesis [BR:ddr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Deide_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1f tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ACO45989
UniProt: C1CUX2
Position
1317603..1319432
Genome map
AA seq 609 aa AA seqDB search
MDLKAQLKAAVEAAAQSMGIPVDAAIQDTPASKPGDYGTPAAFQMAKSAGGNPAQIAAQL
AQTVQLPTGIKRVEAAGPFLNFFLDTAMFVRDVVENPFVMPSLGGKVVIEHTSVNPNKEL
HVGHLRNVVLGDSMARIFRAAGHTVEVQNYIDDTGRQAAEALFAINHYHREWDGTQKYDH
WLGEGYVRLNADPAKPDLEEGISAIMHRLEAGVLRGEVEKVVTAHLQTCFRLGARYDLLN
WESDVVGSGFLTQAMNILESSRYTSRPTEGKYAGAFVMDVSEFMPGLEESNVVLVRSDGT
AMYAAKDIGYQFWKFGLFEGMKFKPFMTDPDGNTVWTSAPDGEPDVQRRFGHADEVINVI
DSRQDHPQTVVRSSLGVAGQYEKKDRSIHLSYAFVTLEGQTISGRKGIAVSADDAMDEAE
KRALAALTELNPDLAAREDAAEIARRIGIGAIRFAMLKAEPTRKIDFRWEQALALNGDTA
PYVQYAAVRAASILRKAQEAGHNINGSGADWDALPDVDLALAKMVARLPEVVAQSVRVHS
PHVVAQYALDLATAFNAWFNAKDRQGKPATNVLQSEPGLREARLALVGRLRRAFEETLDL
IGIEVPAAM
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggacttgaaggcacaactcaaagctgctgtggaggctgccgcccagagcatgggcata
ccggtggacgcagctattcaggacaccccggcttccaagccgggcgattacggcacccca
gcggcgtttcagatggcgaagagcgccggtggaaacccggcccagattgctgctcagctg
gcccagacggtgcagctgcccacgggcatcaagcgtgtggaagcggccgggccgttcctg
aacttcttcctggacacggcgatgttcgtgcgcgacgtggtggaaaatccctttgtcatg
ccgtctctgggcggcaaggtggttattgagcacaccagcgtcaaccccaacaaggaactg
catgtgggccacctgcgcaacgtggtgctgggcgacagcatggcgcgcatcttccgtgcc
gccggccacaccgtggaggttcagaactacatcgatgacaccgggcgccaggccgccgag
gccctgtttgctatcaaccattaccaccgggagtgggacggaactcagaagtacgaccac
tggctgggagaagggtacgttcgcctgaatgccgaccccgccaaacccgacctggaagag
ggcatcagcgcgatcatgcaccgcctggaagccggcgttttgcgcggagaggtcgagaag
gtcgtgactgcgcacctgcaaacctgcttccgcctgggcgcccgctacgatctgctcaac
tgggagtcggacgtggtcggcagtggtttcctgacgcaggccatgaacatcctggagagc
agccgctacacgtccaggccaaccgaggggaagtacgccggcgcctttgtgatggacgtc
tccgagttcatgccaggtctggaagaatccaatgtggtgctggtgcgttccgacggcacg
gccatgtatgccgccaaggacatcgggtatcagttctggaagttcggtctgttcgaggga
atgaaattcaaaccgttcatgactgatcccgacggcaacaccgtgtggaccagtgctccg
gacggggagcccgacgtgcagcgccgcttcggccacgccgacgaggtcatcaatgtgatc
gactcgcgtcaggatcacccgcagacggtggtgcgctccagcctgggggttgcgggccag
tacgagaagaaggaccgcagtattcacctgtcctacgccttcgtgactctggaaggacag
accatcagtggccgcaagggcattgccgtgagcgctgacgacgccatggacgaggccgag
aagcgtgcgctcgcggccctgaccgaactcaacccggatctggctgcccgcgaggacgcg
gccgagattgcccggcgaatcggtatcggtgcaatccgctttgccatgttgaaggccgaa
cccacccgcaaaatcgacttccgctgggagcaggccctggccctgaacggcgataccgcg
ccctacgtgcagtacgccgctgtccgtgccgccagcattctgcgcaaggcccaggaggcc
gggcacaacattaacggcagcggcgccgactgggacgcgctgccggatgtggacctggcc
ctggccaagatggtggcccgccttcctgaagtggtcgctcagagcgtgcgagtccactct
ccgcacgtggtggcccagtacgcgctggacctggcgacggctttcaatgcctggttcaat
gccaaagaccggcagggcaaaccggccacgaatgtgcttcagtccgagcccggcctgcgc
gaagcccgcctcgcgctggtcggtcgcctgcgccgcgccttcgaggaaacgctggacctg
atcggcattgaggttcccgccgcgatgtaa

DBGET integrated database retrieval system