KEGG   Deinococcus deserti: Deide_12330Help
Entry
Deide_12330       CDS       T00880                                 

Gene name
pckA
Definition
(GenBank) putative Phosphoenolpyruvate carboxykinase (ATP) (PEP carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ddr  Deinococcus deserti
Pathway
ddr00010  Glycolysis / Gluconeogenesis
ddr00020  Citrate cycle (TCA cycle)
ddr00620  Pyruvate metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01200  Carbon metabolism
Module
ddr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_12330 (pckA)
   00020 Citrate cycle (TCA cycle)
    Deide_12330 (pckA)
   00620 Pyruvate metabolism
    Deide_12330 (pckA)
Enzymes [BR:ddr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Deide_12330 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ACO46149
UniProt: C1CVD2
Position
1498743..1500326
Genome map
AA seq 527 aa AA seqDB search
MTTLNAPLADLGLKNVRIHLNPGVDQLYADAIRLGEGVRAATGPLAVKTNKTGRSPKDRF
IVEDDLTRDTVWWGGFNTPISPDIFDRLLTKMVAHAEGKELFVQQVYAGTDPKHRIAVRM
VTEMAYHSLFIRNMFVRPSPQELEDFQADWTVLNIPSFKADPATDGVRSDTFIIVNFTKK
MIIAGGTQYAGENKKGIFGVLNFLLPERGVMPMHCSANIGADGDTALFFGLSGTGKTTLS
ADPTRRLIGDDEHGWTDTGVFNFEGGCYAKVINLNPEAEPAIYRTTETYGTVLENVVLRQ
DGTPDLDDGSLTENTRSAYPIDQIDNRQPDGMGGIPRNIVFLTADAYGVLPPISRLSPEQ
MMYQFISGFTAKIPGTEDGVTEPSPTFSTCFGAPFMPRHPGEYARLLAQKVEASGAKVWL
VNTGWSGGMYGQGKRMSLKHTRAMINAALNGELDSVAFEREPFFHLEIPTEVPGVPAEVL
NPREAWADKAAYDETARKLARMFRENFKRFEEGVDPAVTASMPNPDA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgactacacttaatgctcctttagccgatctcggtctcaaaaatgtacgtattcatctg
aaccctggcgtcgatcagctgtatgccgatgccatccgtctgggcgagggagtgcgggcc
gcgactggtccgctggcggtgaaaacaaacaaaaccggccgtagccccaaagaccggttt
atcgtggaagatgacctcacccgcgacacggtgtggtggggaggctttaacactcccatc
tcgccggacatttttgaccgcctgctgaccaaaatggtcgcccacgcggaggggaaggag
ctgttcgttcaacaggtctacgccggcaccgacccgaagcaccgtatcgccgtacgaatg
gtcaccgaaatggcgtaccacagcctgttcatccgcaatatgtttgttcgtcccagccct
caggagctggaagacttccaagccgactggacggtgctcaatatccccagtttcaaggcc
gatccagcgacggacggcgtacgtagcgacacctttatcattgtcaatttcaccaaaaag
atgattattgctggcggtacccagtatgccggcgaaaacaagaaaggcattttcggcgtg
ctgaacttcctgctccccgaacggggtgtcatgcccatgcactgctcggccaatattggg
gcagatggtgacacggccctgttcttcggcctgagtggtaccggtaaaaccaccctgtcg
gctgaccccacccgccgcctgattggcgacgatgagcacggctggaccgacaccggcgtc
ttcaacttcgagggcggctgctatgccaaggtcatcaacctgaacccggaagccgagccg
gcgatctaccgcaccaccgaaacctacggcaccgtgctggaaaacgtcgtgttgcgccag
gacggcacacccgacctcgatgacggctccctgaccgagaacacccgcagtgcctaccct
atcgatcagatcgacaaccgccagccggacggaatggggggtattcccaggaacatcgtc
tttctgactgctgacgcttacggcgtgctgcctcccatcagccgcctgagtccggaacag
atgatgtaccagttcatcagcggcttcacagccaagatccccggcacggaagacggcgtt
accgagcccagcccgaccttcagcacctgtttcggcgccccctttatgccacggcacccc
ggcgaatatgcccggctcctggcgcagaaggtcgaggcgagcggcgcgaaagtctggctg
gtcaacaccggatggagcggcggcatgtatggccagggcaagcgcatgagcctcaaacac
acccgcgccatgatcaacgcagcgctcaatggcgagcttgatagtgttgcctttgaacga
gagcctttcttccacctggaaatccccaccgaggttcccggggttcccgccgaggtcctg
aacccacgcgaggcctgggcagacaaggccgcctacgacgagaccgcgcgcaagcttgcc
cggatgttccgggagaacttcaagcggtttgaggaaggcgtggacccggccgtcaccgcc
agcatgcccaatcccgacgcctga

DBGET integrated database retrieval system