KEGG   Deinococcus deserti: Deide_12440Help
Entry
Deide_12440       CDS       T00880                                 

Definition
(GenBank) putative Succinate dehydrogenase, hydrophobic membrane anchor protein SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ddr  Deinococcus deserti
Pathway
ddr00020  Citrate cycle (TCA cycle)
ddr00190  Oxidative phosphorylation
ddr00650  Butanoate metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01200  Carbon metabolism
Module
ddr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ddr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deide_12440
   00650 Butanoate metabolism
    Deide_12440
  Energy metabolism
   00190 Oxidative phosphorylation
    Deide_12440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Cyt_bd_oxida_II VirB8 CybS
Motif
Other DBs
NCBI-ProteinID: ACO46163
UniProt: C1CVE6
Position
1513133..1513510
Genome map
AA seq 125 aa AA seqDB search
MIRARTFTDARQQSHNNAELNWWIFMRISGLILVFLVLGHIYMTFIQVSESDATFDAVVA
KLSNPAWKFYDWMILFLSLLHGANGARYSIEDYIRSRPNRAWVKSIFYTVIALVFAFGTI
GLISI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgcgcggaccttcaccgatgcccggcagcaatcgcacaacaatgctgagctg
aactggtggatcttcatgcgtatcagcgggttgatcctggttttcctggtgctcgggcac
atctacatgacctttattcaggtcagtgaatccgatgccaccttcgacgcggtggtcgcc
aagctcagcaaccctgcctggaagttctacgactggatgattctgtttctgtccctgctg
cacggtgcgaacggagcacggtattcgattgaggactacatccgttcgcggcccaaccgg
gcctgggtcaagagcattttctacacggtgatcgcgctggtatttgcctttggcacgatc
ggcctgatctccatttga

DBGET integrated database retrieval system