KEGG   Deinococcus deserti: Deide_14140Help
Entry
Deide_14140       CDS       T00880                                 

Definition
(GenBank) putative Indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ddr  Deinococcus deserti
Pathway
ddr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01130  Biosynthesis of antibiotics
ddr01230  Biosynthesis of amino acids
Module
ddr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deide_14140
Enzymes [BR:ddr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Deide_14140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACO46361
UniProt: C1CVZ4
Position
complement(1722760..1723566)
Genome map
AA seq 268 aa AA seqDB search
MTRPPPEPSLPPLNLSAVPGVLGRIVSERAADYDGADPALGPVRPAARRFEAALQSPGLS
LIAEIKRASPSQGAIAPLDPVDAAQAYRQGGAAALSVLTEPRHFDGHPDFLRAVVGAVDL
PALRKDFVIHPAMLREAADWGASAALLMVSVLGEATAAYLEMAHHLGLDALVEVHSDSEL
DLALESGARIIGVNNRDLTTLHIDLDVSPRLIRRAREAGFGGVLVAESGYRTPADLAQVR
GLADAVLVGSSLAGSADLAQATRDLLRE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcccgccgcctgagcccagcctgccgcccctgaacctgagcgccgttccaggc
gtgctggggcgcatcgtgtccgagcgcgccgcggattatgacggcgcagacccggcgctt
ggtccggttcgcccggcagcgcggcgcttcgaggcggcgctgcagagcccgggcctgagt
ctgattgctgagatcaagcgggcaagccccagccagggagccattgcgccgcttgatccg
gtggacgctgcgcaggcctaccggcagggcggcgccgcagccctgagtgtgctgaccgaa
ccgcggcatttcgacggccaccccgactttctgcgggccgtggtaggggcggtggacctg
cctgccctgcgcaaggacttcgtgattcatcctgccatgctgcgggaagcggcggactgg
ggcgcctcggccgcgctgctgatggtcagtgttctgggagaggcaaccgcggcttacctg
gaaatggcccatcacctgggtctggacgccctggtggaggtccacagcgactcggaactg
gacctggccctggagagcggcgcacgcatcatcggggtcaacaaccgcgacctgaccacg
ctgcacattgatctggacgtcagcccgcggctgatccgccgcgcgcgcgaggccggcttc
ggcggcgttctggtggccgaaagcggataccggacgcctgctgaccttgctcaggtccgt
ggcctggccgacgcggtgctggtcggcagcagtctggcaggcagcgcagatctggctcag
gccacccgggacctgctgcgcgagtga

DBGET integrated database retrieval system