KEGG   Deinococcus deserti: Deide_18900Help
Entry
Deide_18900       CDS       T00880                                 

Gene name
rplV
Definition
(GenBank) putative 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ddr  Deinococcus deserti
Pathway
ddr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ddr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Deide_18900 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ddr03011]
    Deide_18900 (rplV)
Ribosome [BR:ddr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Deide_18900 (rplV)
  Bacteria
    Deide_18900 (rplV)
  Archaea
    Deide_18900 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACO46878
UniProt: C1CXG1
Position
complement(2283033..2283452)
Genome map
AA seq 139 aa AA seqDB search
MTAPTPEFRNKKQRKQQVKLRTPGKAIAKYVRMSPRKVRLVVDVIRGKSVSDAEAILRFL
PKSASEPVAKVLNSAKHNALHNDEMLEDRLVITAAYVDAGPTLKRLIPRARGSANILKKR
TSHITIIVGERNDTRGGKR
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccacgcctgaattccgcaacaagaagcagcgcaagcagcaggtcaagctg
cgcacgcctggcaaggccatcgccaagtacgtgcgtatgagcccccgcaaggtgcgcctg
gtcgtggacgtcatccgcggcaagagcgtcagcgacgccgaagcgatcctgcgcttcctg
cccaagagcgcgtccgagcccgtcgccaaggtgctgaacagcgccaagcacaacgcgctg
cacaacgacgagatgctcgaagaccgcctggtcatcaccgccgcctacgtggacgctggt
ccgaccctcaagcgtctgatcccccgggcccgtggcagcgccaacatcctcaagaagcgc
accagccacatcaccatcatcgttggcgagcgcaatgacacccgtgggggcaaacgctaa

DBGET integrated database retrieval system