KEGG   Deinococcus deserti: Deide_20250Help
Entry
Deide_20250       CDS       T00880                                 

Definition
(GenBank) putative enoyl-CoA hydratase (enoyl hydrase) (unsaturated acyl-CoA hydratase)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ddr  Deinococcus deserti
Pathway
ddr00071  Fatty acid degradation
ddr00280  Valine, leucine and isoleucine degradation
ddr00281  Geraniol degradation
ddr00310  Lysine degradation
ddr00360  Phenylalanine metabolism
ddr00362  Benzoate degradation
ddr00380  Tryptophan metabolism
ddr00410  beta-Alanine metabolism
ddr00627  Aminobenzoate degradation
ddr00640  Propanoate metabolism
ddr00650  Butanoate metabolism
ddr00903  Limonene and pinene degradation
ddr00930  Caprolactam degradation
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01212  Fatty acid metabolism
Module
ddr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Deide_20250
   00650 Butanoate metabolism
    Deide_20250
  Lipid metabolism
   00071 Fatty acid degradation
    Deide_20250
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Deide_20250
   00310 Lysine degradation
    Deide_20250
   00360 Phenylalanine metabolism
    Deide_20250
   00380 Tryptophan metabolism
    Deide_20250
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Deide_20250
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Deide_20250
   00281 Geraniol degradation
    Deide_20250
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Deide_20250
   00627 Aminobenzoate degradation
    Deide_20250
   00930 Caprolactam degradation
    Deide_20250
Enzymes [BR:ddr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Deide_20250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACO47030
UniProt: C1CY74
Position
complement(2434316..2435137)
Genome map
AA seq 273 aa AA seqDB search
MNATELLSPDRYPGLSLELHEDGILEIVIRNERTLNSVNAEAHRALTYIWRDIDAAQGVR
CVLIRGEGRGFSSGGDFELIEEMSQDFTALARVWREARDLVYNVINCGKPIVSAIHGPCV
GAGLAVALLSDVSVAAKTARILDGHVRLGVAAGDHAAIIWPLLCGLNKAKYHLMTGEPVS
GEEAERIGLVSLCVEDDQLLDRAWKVARTLAAGSPTAVRWTKYALNNWLRAMGPTFDASL
ALEFLGFTGPDVREGLSSLREKRAPNFMTDAPI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaccgaacttctgtctcccgaccgctaccctggcctcagccttgagctgcac
gaggacggcattctggagatcgtcatccgcaacgagcgcaccctgaactcggtgaatgcc
gaggcacaccgcgccctgacgtacatctggcgggacatcgacgcggcacagggcgtgcgt
tgtgtcctgatccgcggtgagggccgcggcttttcctctggtggagatttcgagctgatc
gaggagatgagccaggacttcaccgcgctggcccgtgtctggcgtgaggcgcgtgacctg
gtctacaacgtgatcaactgcggtaaacccattgtcagcgccattcatgggccctgcgtg
ggtgccggactggcggtggcgctgctttccgacgtcagcgtggccgcaaaaacggcccgt
atcctggacggccatgtgcgtctgggcgtggcggctggcgatcacgctgcaatcatctgg
ccgctgctgtgtggcctgaacaaggccaagtaccacctgatgaccggtgaaccggtcagc
ggtgaggaagccgagcgtatcgggctggtcagcctctgtgtcgaggacgatcagctgctc
gaccgggcctggaaggtggcccgcacgctggctgccggaagccccactgccgtgcgctgg
accaaatacgccctgaacaactggctgcgcgccatgggtcccaccttcgacgccagcctg
gccctggaattcctgggctttaccggccccgacgtgcgtgaaggactgtcgagcctgcgc
gagaagcgcgcgccgaacttcatgacggacgcgccgatctga

DBGET integrated database retrieval system