KEGG   Deinococcus deserti: Deide_21550Help
Entry
Deide_21550       CDS       T00880                                 

Definition
(GenBank) putative serine protease, precursor
Organism
ddr  Deinococcus deserti
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ_2 Trypsin PDZ_6 Tricorn_PDZ Peptidase_S46 PDZ Peptidase_S29 Peptidase_S3
Motif
Other DBs
NCBI-ProteinID: ACO47181
UniProt: C1CZD3
Position
2596801..2597901
Genome map
AA seq 366 aa AA seqDB search
MKAARALALAALLTAAATGAYVTGRVTAQKALVTNDEINTVEVTQKALQAVVRVDVRLRK
DALQPGDDPNETGSGFFYKKDLIVTNYHVIQYQESISVVLYNGRRVPARIEGVDRDIDIA
VLRVSGVTAPKTLAFGQSARLIPGQKLITIGTPLKIQNFVSTGVFSVLASARDVPRGDNL
AQEVGQYLITTASIQQGNSGGPILDSRGAVVGVADANAAPNAVVPGVIGIALPGDLVKQS
LDDLEKIGVPQRGTLGVTLVDLDTLDPALRNLAGLSSSEGALVDEVPAGTAGARAGLRGS
LRNSRGQLLSPLGDIIVAVNGQRVQSSFDVVRLVAAKRPGQTITLRVWRNKKAVDVKVTL
LKRTLQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagcgcgcgccctggcattggcggcgcttctgacagcagcggccacgggcgcg
tatgtcactggccgtgtcacggcgcaaaaggccctcgtcacgaatgacgaaatcaatacg
gtcgaggtcacccagaaggccctgcaggcggttgtccgggtggatgtccgcctgcgcaag
gacgctttgcagcccggggacgaccccaacgagaccggcagcgggtttttctacaagaag
gacctgatcgtcaccaactaccacgtcattcagtaccaggagtcgatcagcgtggtcctc
tacaacggccgacgggtcccggcgcggatcgagggcgtggaccgcgatatcgatatcgcc
gtgctgcgggtcagcggcgtcacggcacccaaaaccctggccttcggtcagagcgcccgg
ctgatcccggggcagaagctcatcactatcggcacgcccctgaagatccagaacttcgtg
agcacaggagtgttcagcgtgctcgccagcgcgcgtgacgtgccgcgcggtgacaatctg
gcgcaggaggtcgggcagtacctgatcaccaccgccagcatccagcagggcaacagcggc
gggcctatcctggattcccgcggcgcggtcgtgggtgtggccgacgcgaatgccgccccc
aacgccgtggtgccgggcgtgatcggcattgcactgccgggtgacctggtcaaacagagc
ctggatgatctggaaaagatcggggttccgcagcgcggcacgctgggcgtcaccctggtg
gatctggataccctggacccggcgctgcgcaaccttgccggcctgagcagcagcgaaggc
gccctggtggacgaggtcccggccggcacggcaggcgcacgtgcgggcctgcgcggctcg
ctgcgcaacagccgcgggcagctgctttcacccctgggcgacatcatcgtggcggtcaac
gggcagcgggtccagagttctttcgacgtggtgcggctggtggccgccaagcgcccggga
cagaccatcacgctgcgggtgtggcgaaacaagaaggctgtggacgtgaaggtcacgctg
ctcaaacgcacgctgcagtag

DBGET integrated database retrieval system