KEGG   Deinococcus deserti: Deide_22090Help
Entry
Deide_22090       CDS       T00880                                 

Gene name
murI
Definition
(GenBank) putative glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ddr  Deinococcus deserti
Pathway
ddr00471  D-Glutamine and D-glutamate metabolism
ddr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Deide_22090 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ddr01011]
    Deide_22090 (murI)
Enzymes [BR:ddr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Deide_22090 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:ddr01011]
 Precursor biosynthesis
  Racemase
   Deide_22090 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACO47237
UniProt: C1CZI9
Position
2662430..2663281
Genome map
AA seq 283 aa AA seqDB search
MSSAAPVGVFDSGVGGLSVLAELRRAMPHEEYLYLADTAHVPIGARSDEEIRDLTDRAVS
ALHARGVKGVVVACNTASAFSLSHLRARFAIPIIGLVPAVKPAVEATRSGVVGVLATPGT
LRGTLLADVIRQFADPAGVKVLQAVSRELVPLVEAGQADSSETQAVLREVLSPLVQAGAD
QLVLGCTHYPFLAGSIHAEFGNCFTLVDSGAAVARHTRRVLAAENLLTARTETGKVTYLV
TGDVDAARPVFATLVSQNVHNEDHTPAAASTQAAPLRIEHIHT
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgcggcgccggtgggcgtgttcgacagcggcgtgggcggcctgagtgtactg
gccgagctgcgccgggccatgccccatgaggagtacctgtatctggccgacacggcgcac
gtgccgatcggagcgcgcagcgatgaggagattcgggatctgactgatcgggcggtcagt
gccctgcatgcccggggagtcaagggcgtagtggttgcctgcaataccgccagtgccttc
agcctgtcgcacctgcgcgcgcgctttgccataccgatcattggactggtaccggccgtg
aagccagcagtagaggccacccgcagcggggtggtaggcgttctggccacgccaggaacc
ctgcgcggaaccctgctggccgacgtgatccggcagtttgccgaccccgcaggagtgaag
gtcctgcaggccgtcagccgtgagttggttccactggtcgaggctggacaggccgacagt
tccgaaactcaggcagtgctccgggaggttctttctccgctggtccaggctggagccgat
caactggtactgggctgcacccattatccgtttctcgccggaagcattcacgccgaattt
ggaaactgttttactctggttgacagcggagcagcggtggccagacatacccggcgcgtg
ctggcagccgagaatctgctgacggcccggactgaaaccggcaaggtgacctatctggtg
acaggcgacgtggacgccgcgcgtccggtgttcgccaccctggtaagtcaaaacgtgcac
aatgaagaccacactcccgcagcggcttccacacaggcagcgccgctgagaatcgagcat
attcatacatga

DBGET integrated database retrieval system