KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1357
Entry
Ddes_1357         CDS       T00837                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K20038  choline trimethylamine-lyase [EC:4.3.99.4]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Brite
KEGG Orthology (KO) [BR:dds00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ddes_1357
Enzymes [BR:dds01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.4  choline trimethylamine-lyase
     Ddes_1357
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACL49259
UniProt: B8J0I2
Position
1631431..1633977
AA seq 848 aa
MDLHDFSSKIAEVTKNLSPEEREQLRKIFATVTLPAQSAPSAAAQPSPAAHSGPGVPEGP
TQRHVLLKENYLKQVPRITIHRARTITKIDKENPGMPRILLRATAFRHCCESAPLIIQDH
ELIVGAPNGAPRAGAFSPEISWRWLRDELDTIDSRAQDPFHLAEEDKKILCEEIFPYWAG
KSVDEYCEAQYREAGLWELSGESYVSDCSYHALNGGGDSNPGYDVILMKKGMLDIQREAR
EHLEQLSYDRPEDIDKIYFYKSVIETTEGVMIYARRMSEYAAQLAARENDPRRKAELLKI
AEVNARVPAHAPTTFWEAIQAVWTVESLLVVEENQTGMSIGRVDQYMYPFYKADIEAGRM
TPYEAFDLAGCMLIKMSEMMWLTSEGSSKFFAGYQPFVNMCVGGVSREGRDATNDLTYLL
MDAVRHVRIYQPSLATRVHNTSPQEYLKKIVSVIRSGMGFPAVHFDDTHIKMMLAKGVDI
EDARDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIELVLNRGVPLWYGKQVCPDLGDLSQ
FDTFEKFDAAVKEQIRYITKWSSVATVISQRVHRDLAPKPLMSIMYEGCMEKGRDVAAGG
AMYNFGPGVIWSGLATYADSMAAIKKLVYDDRKYTLQQLNEALKANFEGYDAILADCLAA
PKYGNDDDYADDIAADLIAFTEREHRKYRTLYSILSHGTLSISNNTPFGQLLGASAGGRK
AWQPLSDGISPTQGADYKGPTAIIKSVSKMSNDNMNIGMVHNFKLMPGLLDTPEGEQGII
TLIRSASILGNGEMQFNYLDNKTMLEAQQNPKDYRDLVVRVAGYSAFFVELCKDVQDEII
SRTVLRHF
NT seq 2547 nt   +upstreamnt  +downstreamnt
gtggatcttcatgatttttcgagcaaaatagcggaagttaccaagaatctttcgcctgaa
gagcgcgagcagttgcgcaagatttttgccactgtcaccctgcccgcccagtcggcccct
tccgcagcggcacagccgtctcccgctgcccactctggtcccggcgtacctgaagggcct
acacagcgccatgtgctgctgaaagaaaactacctcaagcaggttccgcgcatcaccatt
caccgcgcccgcacaatcaccaagattgacaaagaaaaccccggtatgccgcgtattctg
ctgcgcgccactgcttttcgccattgctgcgaaagcgctccgctgattatccaggatcat
gaactcattgtcggcgcccccaacggcgcgccgcgcgccggtgctttttctcccgaaatt
tcctggcgctggctcagggatgagctggataccattgacagtcgcgcccaggaccctttc
caccttgccgaagaagacaaaaagatcctgtgtgaggaaatcttcccctactgggcgggc
aagtctgtagatgaatactgtgaagcacagtaccgcgaagccggtctgtgggaactttcg
ggtgaatcctatgtatccgactgctcctaccacgccctcaacggcggcggcgactccaac
cccggctacgacgtcattctcatgaagaagggcatgctggacattcagcgcgaagcacgt
gaacacctggaacagctgagctatgaccggcccgaggatatcgacaagatctacttctac
aagtcggttattgaaaccaccgaaggcgtcatgatctacgcccggcgcatgtccgaatac
gcggcacagctggccgctcgcgaaaacgaccccaggcgcaaggccgagctgctcaagatc
gccgaggtcaacgcccgcgttcccgcccatgcccccaccaccttctgggaagccattcag
gccgtgtggaccgtggaatcactgctggttgtggaagaaaaccagacaggcatgtccatc
ggccgtgtcgaccagtacatgtaccccttctacaaggccgatatcgaagcgggccgcatg
acgccttatgaagcctttgacctcgcaggctgcatgctcatcaagatgtctgaaatgatg
tggctcaccagcgaaggcagctccaaattctttgccggctaccagcccttcgttaacatg
tgcgttggcggcgtcagccgtgaagggcgcgacgccaccaacgacctgacctatctgctc
atggatgcggtgcgtcatgtgcgcatctaccagccctcgctggctacccgtgtgcacaac
acctcgccccaggaatacctgaaaaaaatcgtgtccgtcatccgttcgggcatgggtttt
ccggctgtgcactttgacgacacccacatcaagatgatgctggccaagggcgtcgacatt
gaagacgcccgcgactactgcctcatgggttgcgtggaaccgcaaaaatccggccgcctg
tatcagtggacgtccacggcatacacccagtggcccatctgcatcgagcttgtactcaac
cgcggcgtgcccctctggtacggcaagcaggtctgccctgacctcggcgatctgagccag
ttcgacacttttgaaaagtttgatgccgccgtcaaggaacagatcaggtacatcaccaaa
tggtcaagcgtggctacggttatctcccagcgtgtccaccgcgacctggcgcccaagccg
ctgatgtccatcatgtacgaaggctgcatggaaaaaggccgcgatgtagccgccggcggt
gccatgtacaacttcggtcccggcgtgatctggagcggccttgcaacctacgccgactcg
atggccgctatcaagaagctcgtgtatgacgacaggaagtacaccctgcagcaacttaac
gaggcgctcaaagccaactttgaaggctatgacgccattctggccgactgcctggccgcg
cccaaatacggcaacgatgatgactatgccgacgatatcgccgccgacctcatcgccttt
accgagcgtgagcaccgcaagtaccggacgctctactccatcctgagccacggtacactg
tccatttccaacaacacgccctttggtcagctcctgggcgcttcggccggcggccgcaag
gcatggcagccgctttccgacggtatcagccccacgcagggcgcggactacaagggtccc
acggccatcatcaagagcgtgtccaagatgtccaacgacaacatgaacatcggcatggtg
cataacttcaagctcatgcccggcctgctggatacccccgaaggcgaacagggcattatc
accctcattcgctctgccagcatacttggcaacggtgaaatgcagttcaactatctggac
aacaagaccatgcttgaagcccagcagaaccccaaagactatcgcgaccttgtggtccgt
gtggcaggctatagcgccttctttgtggaactttgcaaggacgtgcaggacgaaatcatc
agcagaactgtgctgcgccacttctag

DBGET integrated database retrieval system