KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_2017Help
Entry
Ddes_2017         CDS       T00837                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00860  Porphyrin and chlorophyll metabolism
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
dds01120  Microbial metabolism in diverse environments
Module
dds_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dds00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ddes_2017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dds01007]
    Ddes_2017
Enzymes [BR:dds01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Ddes_2017
Amino acid related enzymes [BR:dds01007]
 Aminotransferase (transaminase)
  Class III
   Ddes_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACL49913
UniProt: B8J3A3
Position
complement(2429531..2430802)
Genome map
AA seq 423 aa AA seqDB search
MDTVSRQLFEKAQAVIPGGVNSPVRACHNVDSQPLFIAEAHGCHLTDVDGRQYIDFVLSW
GPMILGHDEPSVTRAVCDAAHRGTSYGAPCPDEVLLAEAVVAAMPSLEMVRMVNSGTEAT
MSALRLARAATRRDKVLKFVGCYHGHADPFLAAAGSGLATFSIPGTPGVPAAVVADTLLA
PYNDLEAVKECFARHGESIAAIIVEPVAANMGLVLPKPGFLEGLRAICDQYESLLIFDEV
ITGFRAAFGGAQARFKVDPDLTTFGKIIGGGLPVGAFGGKRRYMELIAPRGGVYQAGTLS
GNPLAMAAGLATLGILRKADYDGLENRTRAFAYSMRDIIAAKGVPLQMPTLASMFCPYFS
EHEVTDFADAQKCDQKLFTSFYKQMRAQGIYLAPSGYETGMVSFAHTDEDFNRALDAARK
VMF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggacactgtttcgcgccagctttttgaaaaagcccaggctgtcatacccggtggcgtc
aacagccccgtgcgtgcctgccacaatgtggacagccagcctctgtttattgccgaggca
cacggctgtcatcttacggatgtggacgggcggcagtacattgactttgtgctttcctgg
ggtcctatgattcttgggcatgacgaaccttccgtcacgcgtgccgtttgcgatgccgcc
catcgcggcaccagttacggcgccccctgccctgatgaggtgctgctggccgaggccgtg
gtggccgccatgcccagccttgagatggtgcgtatggtcaactcgggcaccgaggccacc
atgagcgccctgcgcctggctcgcgccgccacccggcgtgacaaggttctcaaatttgtg
ggctgctatcacggacatgccgatccttttctggctgccgccggttcgggacttgccacg
ttttccatccccggcacgccgggcgtacccgccgccgtggtggcggataccctgcttgcc
ccgtataacgatctggaagccgtcaaggaatgctttgcccgtcacggcgaaagcattgcc
gccattattgtggagcctgtggcggccaatatgggccttgtgctgcccaagcccggcttt
cttgaaggtttgcgcgccatatgcgaccagtatgaaagcctgcttatctttgacgaggtc
atcacgggctttcgcgcggccttcggcggggcgcaggcgcgcttcaaggtcgaccccgac
ctcaccaccttcggcaagatcatcggtggcggcctgcctgtgggagcctttggcggcaaa
cgccgctacatggaactgatcgctccccggggcggcgtgtaccaggcggggaccctttcg
ggcaatccgctggccatggctgccggtcttgccacactgggcattctcagaaaggcagac
tatgacggccttgaaaaccgtacccgcgcttttgcctacagcatgcgcgacatcattgcc
gccaagggcgtaccactgcagatgcccacgctggcttccatgttctgcccctatttcagc
gaacatgaagtgacggactttgccgatgcgcaaaagtgcgaccaaaagctctttacaagt
ttttacaagcagatgcgcgctcagggtatctaccttgcaccttcgggttatgagaccggc
atggtgtctttcgcccacacggatgaagacttcaaccgcgccctggatgcggcccgcaag
gtgatgttctag

DBGET integrated database retrieval system