KEGG   Denitrobacterium detoxificans: AAY81_01410Help
Entry
AAY81_01410       CDS       T04382                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ddt  Denitrobacterium detoxificans
Pathway
ddt00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ddt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AAY81_01410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ddt01007]
    AAY81_01410
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ddt03016]
    AAY81_01410
Enzymes [BR:ddt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     AAY81_01410
Amino acid related enzymes [BR:ddt01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   AAY81_01410
Transfer RNA biogenesis [BR:ddt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AAY81_01410
 Prokaryotic type
    AAY81_01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ANE22035
UniProt: A0A172RWK5
Position
354048..355538
Genome map
AA seq 496 aa AA seqDB search
MIRIYNTKTREKEDFQSAQLGKVHMYVCGPTVYNYIHIGNARTFISFDVIRRYLSWRGFD
VTFVQNITDVDDKIINKANEEGRSAAEVAQEYTEAFIADMHAMGVLDPDVRPKATEEIPA
MIELVQKLIDAGCAYEAEGDVYFSVRSWEKYGALSGRDVNELESGHRDLRTEGIGDRKRD
SLDFAVWKAAKPGEPAWESPWGMGRPGWHIECSAMAKKYLGLPLDIHGGGADLVFPHHEN
ETAQSEAGYGETFCNYWMHSGMLRINSEKMSKSLGNFLLLRDVLATTKPDVLRMLMLQTH
YRSPLDFSQDRLDEAEAALERISGLVARLDWAMKNAQDIPSPLDTRTIMKRTKEMRNEFI
VTMDDDFNTAGALGVLFAFVGELNTQLGDKTCSLTDVPILRGAHTVIIELMSVFGIMLGQ
EEEGSDFPQEVVDLSRELTGYTGANPKQAVDVLLAARAEARKNRDFALADKVRDGLAGLG
FTIEDTPQGARVTYNA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatttacaatacgaagacgcgcgagaaggaagacttccagagcgctcagctg
ggcaaagtgcacatgtacgtgtgcggccccacggtttacaactacattcacatcggcaat
gcccgcacgttcatcagcttcgacgtcattcgtcgatacctttcgtggcgtggcttcgat
gtcacgttcgtgcagaacatcaccgacgtcgatgacaagattatcaacaaggcaaacgaa
gagggccgcagtgccgccgaggtcgcccaggaatataccgaggcgttcatcgccgacatg
catgccatgggcgtgctcgaccccgacgtgcgcccgaaggccaccgaggaaattcccgcg
atgatcgagcttgtgcagaagctcatcgatgctggctgcgcatacgaggccgaaggcgac
gtgtacttcagcgtccgcagttgggaaaagtacggcgccctttctggccgcgacgtgaac
gagctggaaagcggccatcgcgacctgcgcaccgagggtatcggcgatcgcaagcgcgat
tcgctcgacttcgccgtctggaaggccgccaagcccggcgagcccgcgtgggaatccccc
tggggcatgggccgtcccggctggcacatcgagtgctcggccatggccaagaagtacctg
ggccttccgctcgacatccatggtggcggcgccgacctggtgttcccgcatcacgaaaac
gagacggcgcagagcgaagccggttatggcgagacgttctgcaactactggatgcacagt
ggcatgctgcgcatcaattccgagaagatgagcaagtcgctgggcaacttcctgttgctg
cgcgacgtgcttgccaccacgaagcccgatgttctgcgcatgctcatgctgcagacgcac
taccgcagcccgctcgacttctcccaggaccgcctggatgaagccgaagctgccctcgag
cgcatttcgggcctggtagcgcgcctggattgggctatgaagaacgcccaggacatcccc
agcccgctcgatacgcgcaccatcatgaagcgcaccaaggaaatgcgcaacgagtttatc
gtcaccatggacgatgacttcaataccgctggcgctctgggcgtgctgttcgccttcgtg
ggcgagctcaacacccagctgggcgacaagacctgctcgcttaccgacgtgcctatcctg
cgtggcgcccatacggtaatcatcgagctcatgagcgtgttcggcatcatgctgggccag
gaggaagaaggctccgacttcccgcaggaagttgtcgacctttcccgcgagcttacgggc
tacacgggcgcgaatcccaagcaggcggtcgacgtgctgctggccgctcgtgccgaggcg
cgcaagaatcgcgacttcgcgctggctgacaaggtccgcgacggtcttgcgggcctgggc
ttcaccatcgaagacacgccccagggtgcgcgcgttacgtataacgcgtaa

DBGET integrated database retrieval system