KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0657Help
Entry
DehaBAV1_0657     CDS       T00518                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00010  Glycolysis / Gluconeogenesis
deb00020  Citrate cycle (TCA cycle)
deb00620  Pyruvate metabolism
deb00633  Nitrotoluene degradation
deb00640  Propanoate metabolism
deb00650  Butanoate metabolism
deb00680  Methane metabolism
deb01100  Metabolic pathways
deb01120  Microbial metabolism in diverse environments
deb01130  Biosynthesis of antibiotics
deb01200  Carbon metabolism
Module
deb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_0657
   00020 Citrate cycle (TCA cycle)
    DehaBAV1_0657
   00620 Pyruvate metabolism
    DehaBAV1_0657
   00640 Propanoate metabolism
    DehaBAV1_0657
   00650 Butanoate metabolism
    DehaBAV1_0657
  Energy metabolism
   00680 Methane metabolism
    DehaBAV1_0657
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DehaBAV1_0657
Enzymes [BR:deb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DehaBAV1_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_9 Fer4_21 Fer4_16 Fer4_7 Fer4_2 Fer4_17 Fer4_10 Fer4_6 Fer4_4 Fer4_8 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABQ17242
Position
646945..647241
Genome map
AA seq 98 aa AA seqDB search
MAKQENQITWQEVTPGCIVSEPGNASQYKTGDWRSQLPIHNFKKCIKCGVCYIFCPEGCI
NETKEGFFEADLFYCKGCGICAHECPTGAIVMKDEEEK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaacaggaaaaccagattacctggcaggaagtgacacccggctgtatagtcagt
gaacccggcaatgccagccagtacaagaccggtgattggcgttcccaactacctattcac
aattttaaaaaatgtataaaatgcggcgtatgctatatattttgccccgaaggttgcata
aatgagaccaaagagggctttttcgaagcagaccttttctattgcaagggttgcggcatc
tgcgctcatgaatgtcccaccggagctattgttatgaaggatgaggaggagaaataa

DBGET integrated database retrieval system