KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0917Help
Entry
DehaBAV1_0917     CDS       T00518                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00260  Glycine, serine and threonine metabolism
deb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01130  Biosynthesis of antibiotics
deb01230  Biosynthesis of amino acids
Module
deb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DehaBAV1_0917
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DehaBAV1_0917
Enzymes [BR:deb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DehaBAV1_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ17499
Position
903290..904654
Genome map
AA seq 454 aa AA seqDB search
MVQTKFILQEKDMPQVWYNIQPDLPVPLPPVLHPGTGKPVTPADMEAIFPMNLIMQEFSP
ERHIPIPEELLELYKIWRPTPLYRAHRLEKALQTPAKIFYKLEDVSPAGSHKPNTALAQA
YYNKQAGIKRISTETGAGQWGSSLAMACKFFDIECKVYMVKVSYNMKPYRRIMMETWGAS
VVPSPSPDTRIGREILERDPECPGSLGIAISEAVEDAVTHPGTKYALGSVLNHVLLHQTI
IGQEAKKQMAMADCYPDIVIGCVGGGSNFGGIAIPFVEDKLNGTHKDTRILAVEPASCPS
LTKGLDAYDFGDEAGMTPMMKMFTLGHQFMPPPVHAGGLRYHGMSPLLSHLSRLKLIEAT
AVQQIETFEAGMQFAQTEGFISAPETNHAIRATIDEALKCRETGEAKTILFCHSGHGHVD
MASYDLYLRGKLSNYEYPAELVKEAQKGLPKVNV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaccaagttcatactacaggaaaaggatatgcctcaggtctggtacaatatc
cagcctgatttgcccgtaccgctgcctcccgttttgcatccgggcaccggcaagccggtc
actccggctgatatggaagctatattccctatgaaccttatcatgcaggagttcagcccc
gaaaggcatatacccatcccggaagaactgttggaactatataaaatctggcggccaacc
cctctttaccgtgcccaccggctggaaaaggctttgcagactccggctaaaatattttac
aaactggaagatgtcagcccggccggttcacacaaacccaataccgccctggctcaggct
tattacaataaacaagccggcataaagcggatttccaccgaaaccggcgccggacaatgg
ggttcttctctggctatggcttgcaaattctttgacatagagtgcaaggtctatatggta
aaggtaagctacaatatgaaaccttaccgccgcattatgatggaaacctggggtgcctct
gtcgtacccagccccagcccggatacccgaataggccgtgagatactggaacgtgacccc
gaatgccccggcagtttgggtattgccataagcgaagctgtggaagatgctgtaacccat
cccggcaccaagtatgctctgggtagtgtacttaaccatgtactccttcaccagactatt
atcggtcaggaagctaaaaagcagatggccatggcagactgctaccctgatattgttatt
ggctgtgttggcggcggttcaaactttggcggtatcgctataccctttgtggaagacaaa
ctgaacggtactcacaaggatacccgcattttggcagttgagcccgccagctgtccttca
ctgaccaagggtctggacgcctatgacttcggagacgaagccggtatgacccctatgatg
aaaatgtttacgctgggtcaccagtttatgccacctccggtacatgccggcgggttgcgg
tatcacggcatgtctcccctgctgtctcacctcagccgcctgaagctgattgaggctaca
gcggttcagcagatagagacctttgaagcgggcatgcagtttgcccagactgaaggcttc
ataagcgcacctgaaaccaaccatgccatcagggctacaattgatgaagccctgaaatgc
cgcgaaaccggcgaagccaagactattctcttctgccacagcggtcacggccacgtggac
atggcttcttacgacctgtacctgcggggcaagctcagtaactacgaatacccggcagaa
ctggtaaaagaggctcagaagggtttgcctaaagtcaacgtctag

DBGET integrated database retrieval system