KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1009Help
Entry
DehaBAV1_1009     CDS       T00518                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00240  Pyrimidine metabolism
deb00250  Alanine, aspartate and glutamate metabolism
deb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DehaBAV1_1009
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DehaBAV1_1009
Enzymes [BR:deb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     DehaBAV1_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABQ17589
UniProt: A5FQE1
Position
997588..998583
Genome map
AA seq 331 aa AA seqDB search
MTHIPKTPADTETLLSEVQGWKHRHVLDLDNFSREELDMVMQTAGVMLDILSRPVKKVPA
LKGKTIATLFYEPSTRTRSSFELAAKSLSADVLNLNVSQSSISKGESLLDTLDTLESLGA
DMVVMRHPLSGAPYLAANNCHANIINAGDGWHAHPSQALLDIFTILRHKSSLEGLKITLI
GDIKHSRVAHSNIWGLSKMGAKITLCAPYTLLPEGLNTNSKIFPEVTLETDIKQAVSGAD
VVMGLRLQRERQQSGLLPGIREYARYFQLNEEILKLAKSNALVMHPGPVNEDIELSQSVV
HGEQSVIKEQVKNGVAVRMALFYLCSGSKEI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacacacatacccaagacacccgcagacacagaaaccctgctttcagaagtacaaggc
tggaaacatcgccatgtacttgatctggataacttcagccgtgaagaactggatatggtt
atgcagacagccggcgttatgctggatatcctgtcccgcccggtaaagaaagtgccggca
cttaaggggaaaaccatagctacccttttttacgaaccttccacccgtacccgttcatca
tttgagctggcggccaaaagcctttcagccgatgtgttaaacctgaatgtttcccagagc
agtatctccaagggggaaagcctgctggatacgctggatacgctggaatcactgggggcg
gatatggtagtcatgcgccaccccctgtcaggagcgccttatctggcggcaaacaactgc
catgcaaacattataaacgccggtgacggctggcatgcccaccccagtcaggcactgctg
gatatatttaccatactaaggcacaaatccagcttggaagggctgaaaataaccctgata
ggggatataaaacacagccgggtagctcactccaatatctgggggctaagcaaaatggga
gccaaaatcaccctgtgcgccccgtataccctgctacctgaaggacttaataccaatagc
aaaatattccctgaagtcacactggaaacagatataaagcaagcagtcagcggagctgac
gtggtaatggggctgcgcctgcagcgtgaacgccagcaaagcgggcttctgcccggaata
cgggaatatgcccgatacttccaactgaacgaagaaatactgaaactggcaaaatcaaac
gcccttgtcatgcaccccggcccggtaaatgaagatatagaactttcacagtctgtagtg
cacggagaacagtctgtcataaaagaacaggtaaaaaacggggtagcggtacgcatggca
ctcttctatctgtgcagcggaagcaaggaaatataa

DBGET integrated database retrieval system