KEGG   Dehalobacter sp. CF: DCF50_p1007Help
Entry
DCF50_p1007       CDS       T02279                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
dec  Dehalobacter sp. CF
Brite
KEGG Orthology (KO) [BR:dec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dec03009]
    DCF50_p1007
Enzymes [BR:dec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     DCF50_p1007
Ribosome biogenesis [BR:dec03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DCF50_p1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AFV05012
UniProt: K4L129
Position
1062335..1063231
Genome map
AA seq 298 aa AA seqDB search
MNANKLFTYTLTPEDDGRKYQDILLRRFHFSRKVLQKLKVGENVWIDGKFTYLTARGKTG
QTLVVNILEEEPATVSGETLPIEILFEDEIFLAVNKPPGQVIHPNSRYRTGTLANAVVGY
WESKGETRPFRPVSRIDRNTSGVVLIAKSRYAHQQLAALAIRNKVEKKYLGIVEGNFPLE
QGEWPLPIRLKPGSKIIREAHPDGQSALTLFRTLQHYPDYTLMEFTLVTGRTHQIRVHAQ
AAGHPLLGDDLYGGSMKYMQRQALHCYRYGFMHPLTMQPLQIQAPVPEDIAMLIQSKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaataaattattcacatacactttaacgcccgaagatgacggcaggaaatac
caggacatacttctaagacgcttccatttttcccgcaaggtgctgcaaaagctgaaagtc
ggtgaaaatgtctggattgatggcaaattcacctacctgactgcccggggcaaaaccgga
cagaccctggtcgtgaatatcctggaagaagagccggcaacggtctccggagaaacgctg
cctattgagattctctttgaagatgaaatcttcctcgcggtcaacaaaccacccggccaa
gtcatccaccccaactcgaggtatcggaccggaacgctcgcgaacgcggtagtcggttac
tgggaaagcaaaggtgaaaccaggcctttccggccagtctcgcggatcgaccgcaatacg
tccggcgttgtgctgatcgccaaatcccgctatgcccaccagcagctggccgcccttgct
atcagaaacaaagttgaaaagaaatatctcggtattgtggaagggaattttcctttggag
cagggcgaatggcccctcccaatccggcttaaaccgggcagcaagattatacgggaagct
catccggacggacagtcggcgctgacgctgtttcgaacgttgcagcattacccggactat
accctgatggaattcaccctagtcaccggtcggacgcaccagatcagagtacacgctcaa
gccgccggccatccccttttaggagatgatttgtatggcggcagtatgaaatatatgcaa
aggcaagccctgcactgttatcgctatggtttcatgcatcccttaactatgcagcctctt
caaatccaggctccggtaccggaggatatcgctatgcttatccaaagcaaaaaataa

DBGET integrated database retrieval system