KEGG   Dehalobacter sp. CF: DCF50_p1130Help
Entry
DCF50_p1130       CDS       T02279                                 

Definition
(GenBank) Glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DCF50_p1130
Enzymes [BR:dec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     DCF50_p1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn
Motif
Other DBs
NCBI-ProteinID: AFV05135
UniProt: K4L0R0
Position
complement(1186539..1186970)
Genome map
AA seq 143 aa AA seqDB search
MGNKKYKIGYTTGVFDLFHIGHLNILKRAKDLCDYLIVGVSTDELVREYKHKKPVMSYFE
RSSIVEAIRYVDKVVPQTTMDKIQAFKELNFEVMFHGDDWKGTPLYDKYKKEFEKVGVKM
VFLPHTPGISTTDVKESIQKGHS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
ttggggaataagaaatataaaataggctatacaacaggtgtatttgatttatttcatatt
ggacatttgaatattttaaaacgggctaaagatttatgtgattatcttatagttggagtt
agtactgatgaattagttcgtgagtataaacacaaaaaaccggtaatgtcttattttgag
cgttcaagcattgtagaagcgattcgatatgtagataaggttgttccacaaaccacaatg
gataagatccaagcatttaaggaacttaattttgaagttatgttccatggcgatgattgg
aaagggactcctctgtatgataaatacaaaaaagaatttgaaaaggtaggagtaaaaatg
gtttttttaccacatactccaggaatatctaccacagatgttaaagagagtattcagaaa
ggtcatagttaa

DBGET integrated database retrieval system