KEGG   Dehalobacter sp. CF: DCF50_p1450Help
Entry
DCF50_p1450       CDS       T02279                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00230  Purine metabolism
dec01100  Metabolic pathways
Module
dec_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DCF50_p1450
Enzymes [BR:dec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DCF50_p1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 AAA_16 AAA_17 NTPase_1 RNA_helicase AAA ATP_bind_1 Cytidylate_kin dNK RsgA_GTPase Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: AFV05456
UniProt: K4L4C5
Position
complement(1481628..1482209)
Genome map
AA seq 193 aa AA seqDB search
MEDKGLLIVVSGPAGVGKGTLCKRLFAECGDLEYSVSVTTRAPRPGETEGKEYYFRSRDQ
FLKMVENNEFLEWAEFCGNLYGTPRFHVESVLKRNKTILLEIDMQGAKIVKKAFPDGVFI
FIVPPSLEELAERLYGRGTETPEVVQRRLAQAVQEMKNMKDYDYAVENDEIGTAVEKLKS
IMIAEKCRVSSKP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaaaggactgctgattgtggtttcaggtcctgcaggagttggaaaaggaaca
ctgtgtaagcggctttttgccgagtgcggcgatctggaatattctgtttctgtaacgact
agggcaccaagaccgggagaaacagagggaaaagaatactattttcgttccagggatcaa
tttcttaaaatggttgagaataatgagtttctggaatgggcagagttttgcggaaacctg
tatggaaccccaagatttcatgtggaaagtgtcctgaagagaaacaagaccatcttactg
gaaatcgatatgcagggagcaaaaattgtcaaaaaggcttttccggatggtgtgtttatt
ttcattgttccgccttccctggaagagctcgctgaaaggctttatggaagaggaacggaa
acacctgaggtcgtgcagcgcagactggcacaagccgttcaggaaatgaaaaatatgaag
gattatgattatgctgttgagaacgacgaaattggcactgcagtagaaaagcttaagagt
attatgattgcagaaaaatgccgggtgagttcaaagccataa

DBGET integrated database retrieval system