KEGG   Dehalobacter sp. CF: DCF50_p1844Help
Entry
DCF50_p1844       CDS       T02279                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dec  Dehalobacter sp. CF
Brite
KEGG Orthology (KO) [BR:dec00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DCF50_p1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AFV05846
UniProt: K4L5G2
Position
complement(1878706..1879716)
Genome map
AA seq 336 aa AA seqDB search
MSSLHIALFVVVLFALAFDFINGFHDTANAIATSVSTRALTPRTAIIMAAVLNFIGAMYS
TGVAKTIAKDIVDANSVTSEVMIAALIGAIFWNLLTWYFGIPSSSSHAIIGGILGAGIAA
AGLGVVQGAGIKKIILALLCSPLVGMGLGYLIMTILYYLFRNKAPMKTNSIFRRLQMVSA
ALLAFNHGSNDAQKSMGIITLALVAMGVQSTMDVPLWVKLLCGLAIACGTAVGGWRIIHT
LGAKIFKIEPINGFAADLSSSIVIWVATAFPGLHLPVSTTHVVSGSIMGVGAAKRISAVR
WGVAQQMLIAWCLTIPSTAIVAALSYYLITLVERIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtctgcatattgcattattcgttgtcgtactatttgcgttggcatttgatttt
atcaacggatttcatgatactgccaatgccatagccacttcggtttcgacaagagcgctt
acgccaagaaccgcaatcattatggccgcggtactcaattttatcggcgcgatgtacagt
acaggggttgccaagaccattgcaaaggacattgtcgatgcgaacagtgttacttccgaa
gtgatgatcgccgcactgatcggagcgattttctggaatcttttgacatggtattttggt
attccgagcagttcttcccacgcgattattgggggaatcctcggagccgggatcgctgca
gcgggactcggtgttgtccagggggccggcatcaagaaaattatcttggcgctgctgtgc
tcgccgctcgtcggcatgggactcggttatctgatcatgaccattctatattacttattc
cgcaataaagcgccgatgaaaacgaacagtatcttccggaggctgcagatggtttcagcc
gcactacttgcgtttaaccacggttccaatgatgcacagaaatccatgggtattatcacg
ctggcgcttgtcgccatgggggtacagtcgacaatggatgttccgctctgggtaaagctc
ctgtgcggattagccattgcttgtggtacagcagtgggtggttggagaatcattcatacc
cttggtgctaaaatctttaaaattgagccgatcaacggatttgccgcagacttgtcatcc
tcgatcgttatctgggtagcgacggcgtttccgggtctccatctgccggtcagtaccacg
cacgtggtatccggttccattatgggagtaggcgctgccaaacgtatttcggccgtgcgc
tggggcgttgcgcagcagatgctgattgcctggtgtctgacgattccttccacagcaatc
gtcgcagctctgtcttattatctgattacactcgtggagagaattctctga

DBGET integrated database retrieval system